KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_604Help
Entry
BVAF_604          CDS       T01398                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BVAF_604 (tpiA)
   01230 Biosynthesis of amino acids
    BVAF_604 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BVAF_604 (tpiA)
   00051 Fructose and mannose metabolism
    BVAF_604 (tpiA)
   00562 Inositol phosphate metabolism
    BVAF_604 (tpiA)
Enzymes [BR:bva01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BVAF_604 (tpiA)
Exosome [BR:bva04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BVAF_604 (tpiA)
  Exosomal proteins of bladder cancer cells
   BVAF_604 (tpiA)
  Exosomal proteins of melanoma cells
   BVAF_604 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
685222..686037
Genome map
AA seq 271 aa AA seqDB search
MTSPLIIGNWKLNGTRQKIQESLSILTKEKIIQYKKHIDVAIAPPIVYLSLVNDYLLKNC
TYFSNQTKHKYIELCAQNVDINLSGAFTGDISAAMLKDLGVKYVLIGHSERRKYHKENTT
YIAKKITTVKKIKLIPILCIGENQQDYDSGSTQLTCAYQIDSVINLTGIQAFKNTIIAYE
PIWAIGNGINVCPKHVQSIHEFIRQRIALHDTHIAKQILIQYGGSVNLNNAIQLLEQKDV
NGLLIGAASLNMNTFIQIIQTIEQYLQNKLY
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacatccccattaataataggtaattggaaactaaatggcacacgacaaaaaatacaa
gaatcattatctattttaactaaagaaaaaataattcaatataaaaaacatattgatgta
gctatagctcctcctatagtatatctaagtttagttaatgattacctattaaaaaattgc
acctacttttctaatcaaactaagcacaaatatattgaattatgcgctcaaaatgtcgac
attaatttatcaggtgcattcactggagatatctcagcagcaatgctaaaagatttagga
gtaaaatatgtccttattggacattctgaacgcagaaaatatcacaaagaaaatactaca
tatatcgcaaaaaaaatcactactgtaaaaaaaataaaattaatacctattttatgtatt
ggagaaaaccaacaagactacgactctggatccacacaactaacatgcgcttatcaaatt
gactctgtaattaacttaacaggaatacaggcatttaaaaatacaattattgcttacgag
cctatatgggcaatcggtaatggaataaatgtatgcccaaaacatgtacaatcaattcat
gaatttatacgacaacgcattgctctacatgatacacacatagcaaaacaaatattaata
caatacggcggttccgtaaatttaaataatgctattcaacttcttgaacaaaaagacgtc
aatggattattaattggagctgcttctttaaacatgaacacttttattcaaattatacaa
actattgaacaatatcttcaaaataaactttactaa

DBGET integrated database retrieval system