KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_605Help
Entry
BVAF_605          CDS       T01398                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:bva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BVAF_605 (pfkA)
   01230 Biosynthesis of amino acids
    BVAF_605 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BVAF_605 (pfkA)
   00030 Pentose phosphate pathway
    BVAF_605 (pfkA)
   00051 Fructose and mannose metabolism
    BVAF_605 (pfkA)
   00052 Galactose metabolism
    BVAF_605 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BVAF_605 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BVAF_605 (pfkA)
Enzymes [BR:bva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BVAF_605 (pfkA)
Protein phosphatases and associated proteins [BR:bva01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BVAF_605 (pfkA)
Messenger RNA biogenesis [BR:bva03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BVAF_605 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(686079..687044)
Genome map
AA seq 321 aa AA seqDB search
MIKRIGVLTSGGDSPGMNAAIRGVVRTGLSEGLEVYGIYDGYLGLFQNRMILLNHCSVSD
IINRGGTFLGSSRFPDFRKYTIREKVVRNIKKRNLDALVIIGGDGSYIGAKKLSDMGCPC
IGLPGTIDNDVSGTDYTIGYFTALETIIEAIDRLRDTSSSHQRVSIVEVMGRYCGDLTIA
AAIAGGCEFVVVPELKFEVQDLVNKVKFDIAKGKKHAIVAITEHICNVFDLAKYIEKKTG
KETRATVLGYIQRGGKPVAYDRILGSRMGVYSVELLLQGCSGCCIGIQNEKLVYNDISSI
IQQCVHRPFRQDFFRTAKRLF
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaagaataggagtattgacaagtggtggagattctcctgggatgaatgcagct
attcggggagtcgttcgtacggggttgtctgaaggtttagaagtttatggtatatatgat
ggttatttgggattattccaaaatcgtatgattttattaaatcattgtagtgtatcagat
ataattaatagaggtggtacgtttcttggatcttctcgttttccggattttagaaaatat
actattagagaaaaggttgtgcgtaacattaaaaaacgtaatcttgatgctctagtgatt
ataggtggggatgggtcttatattggtgcaaaaaagttaagtgatatgggatgtccttgt
attggattacctgggactattgataatgatgtttctggaacagattatactattggttat
tttacagctttagaaacaattattgaggcaattgatcggttacgggatacttcttcttca
catcaacgtgtttctattgtggaggttatgggtcgttattgtggagatttaactatagca
gcagctatagcaggaggttgtgaatttgttgttgtacctgaattaaaatttgaagtgcaa
gatttagttaataaagtcaaatttgatattgctaagggtaaaaaacatgcaatagttgct
attactgagcatatttgtaatgtatttgatttagcaaagtatattgagaaaaaaaccgga
aaggaaactcgagccactgttttaggatatattcaacgtgggggaaaaccagttgcgtat
gatcgtattttaggatctagaatgggggtgtattctgttgaattgttattacagggatgt
agtgggtgttgtattggaattcaaaatgaaaaattagtatataatgatattagtagtatt
atacaacaatgtgttcatcgaccatttcgacaagatttttttaggacagcaaaaagatta
ttttaa

DBGET integrated database retrieval system