KEGG   Burkholderia vietnamiensis: Bcep1808_0036Help
Entry
Bcep1808_0036     CDS       T00493                                 

Definition
hypothetical protein
Organism
bvi  Burkholderia vietnamiensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:43273..43656
Genome map
AA seq 127 aa AA seqDB search
MKTQRYLSALAAALLALGAVGAQAAAGGNGGGGGGGHGAGGMGGMGGNAGGMSGSHMSGD
ALSNSNGFRSGDRDKGLARATDRSDTIADRAGVQPGHGHAHTHGHTAHATTATSTHHGHR
NALGRTL
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcaacgatatctgtccgcgctggcagcggcgctgctcgcactcggggccgtc
ggcgcacaggcggcggctggcggcaatggcggtggtggtggcggcggccatggcgcaggc
gggatgggcggcatgggcggcaacgcgggcgggatgtccggtagccacatgagcggcgac
gcgctgagcaattcgaacggcttccgctcgggcgaccgcgacaagggcctcgcacgcgcg
accgatcgctccgacacgatcgccgaccgcgccggcgtgcagcccggccacggtcacgcg
catacgcacggccataccgcgcatgcgacgacggcgacctcgacgcatcacgggcatcgc
aacgcgctcggccgcacgctgtaa

DBGET integrated database retrieval system