KEGG   Burkholderia vietnamiensis: Bcep1808_0204Help
Entry
Bcep1808_0204     CDS       T00493                                 

Definition
BadF/BadG/BcrA/BcrD type ATPase
Orthology
K18676  
glucosamine kinase [EC:2.7.1.8]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bcep1808_0204
Enzymes [BR:bvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.8  glucosamine kinase
     Bcep1808_0204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:230393..231274
Genome map
AA seq 293 aa AA seqDB search
MTALLFAIGIDGGGTGTRAVLADRHGRELAQGRGGPSGLGLGIERAWASIGTACADAFTQ
AGLALNWSQCALGCGLAGVNNAAWLAAFRAHAPLDALAVESDAYTTLVGAHGGAPGLIVA
LGTGSIAAALDAAGDCRIAGGFGFPSGDEASGAWLGMRALAYAQQALDGRVPRDAFAEAL
LGATGADDRDALVQWSCDANQTIYARLAPIVFAHRDHPHAAALIAQAGEEIGKMIDALDP
RHALPVALCGGLADALAPAVPERHAARLRAPLDDSAHGALRLALKALAAAGAG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgacggcattactttttgcaatcggcatcgacggcggcggcaccggcacccgcgcggtg
ctcgccgaccggcacggccgtgaactcgcccaggggcgcggcggcccgtcggggctcggc
ctcggcatcgagcgcgcctgggcgtcgatcggcacggcctgtgccgacgcgttcacgcaa
gccggactcgcgctgaactggtcgcaatgcgcgctcggctgcgggctggcgggcgtcaac
aacgcagcctggctggccgccttccgcgcgcatgcgccgctcgacgcgctcgcggtcgaa
agcgacgcatatacgacgctggtcggtgcgcacggcggcgcgccggggctcatcgtcgcg
ctgggcaccggcagcatcgcggcggctctcgatgcggcaggcgattgccgcatcgcaggc
ggcttcggctttccgtccggcgacgaggcaagcggcgcgtggctcggcatgcgtgcgctt
gcttacgcgcagcaggcgctcgatggccgtgtgccgcgcgacgcgtttgccgaggcgctg
ctcggcgcaacgggcgcggacgatcgcgacgcgctcgtccagtggtcgtgcgacgcgaac
cagaccatctacgcgcggctcgcgccgatcgtgttcgcgcatcgcgaccatccgcatgcg
gccgcgctgatcgcgcaggccggcgaggagatcggcaagatgatcgacgcgctcgacccg
cggcacgcgctgccggttgcgctgtgcggcgggctggccgacgcgctcgcgccggccgtg
cccgagcgccacgcggcgcgcttgcgggcgccgctcgacgattccgcgcacggcgcgttg
cggctcgcgctgaaggcgctggcggccgcgggcgcaggatag

DBGET integrated database retrieval system