KEGG   Burkholderia vietnamiensis G4: Bcep1808_0220Help
Entry
Bcep1808_0220     CDS       T00493                                 

Definition
(GenBank) response regulator receiver modulated CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi02020  Two-component system
bvi02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bcep1808_0220
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Bcep1808_0220
Enzymes [BR:bvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Bcep1808_0220
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Bcep1808_0220
Two-component system [BR:bvi02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Bcep1808_0220
Bacterial motility proteins [BR:bvi02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Bcep1808_0220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: ABO53236
JGI: Bcen18080220
UniProt: A4JAD3
Position
1:246693..247784
Genome map
AA seq 363 aa AA seqDB search
MTAVQKIKVLCVDDSALIRSLMTEIINSQPDMMVCATAPDPLVARELIKQHNPDVLTLDV
EMPRMDGLDFLEKLMRLRPMPVVMVSSLTERGSEITLRALELGAVDFVTKPRVGIRDGML
DYAEKLADKIRAAARARVRQTPQPHAAARAANGQPAAPMFNNPLVSTEKLIIIGASTGGT
EAIREVLTPLPPDAPAVLIAQHMPPGFTKSFAQRLNGLCRIAVKEAEHGERVLPGHAYIA
PGHAHLLLARSGANYIAQLSDDPPVNRHRPSVDVLFRSAAQHAGKNAIGVILTGMGRDGA
AGLLDMKRAGAHTFAQDEASCIVFGMPREAIALGGADEVAPLAEMSRRVMARLATMGDRV
QRV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagtgcagaagatcaaagtgttgtgcgtcgacgactcggcgctgatccgcagt
ctgatgaccgagatcatcaacagccagcccgacatgatggtgtgcgcgaccgcgcccgat
ccgctcgtcgcgcgcgagctcatcaagcagcacaaccccgacgtgttgacgctcgacgtc
gaaatgccgcgcatggacgggctcgacttcctcgagaagctgatgcgcctgcggccgatg
ccggtcgtgatggtgtcgtcgctgaccgagcgcggctccgaaatcacgctgcgcgcgctc
gaactcggcgcggtggatttcgtcacgaagccgcgcgtcgggattcgcgacggcatgctc
gactacgcggagaagctcgcggacaagatccgcgcggccgcgcgcgcgcgcgtgcgccag
acgccgcagccgcacgccgccgcacgcgcggcgaacggccagccggccgcgccgatgttc
aacaacccgctcgtcagtaccgagaagctgatcatcatcggcgcgtcgacgggcggcacc
gaggcgatccgcgaggtgctgacgccgctgccgcccgatgcgccggccgtgctgatcgcg
cagcacatgccgccgggcttcacgaagtcgttcgcgcagcggctgaacggcctgtgccgg
atcgcggtgaaggaagccgagcatggcgagcgcgtgctgcccggccatgcgtacatcgcg
cccggccacgcgcacttgctgctcgcgcgcagcggcgcgaactacatcgcgcagctgtcc
gacgatccgccggtgaaccgccatcggccgtcggtcgacgtgctgttccgctcggcggcg
cagcacgcgggcaagaacgcgatcggcgtgatcctgaccggcatgggccgcgacggcgcg
gccgggctgctggacatgaagcgcgcgggcgcccacacgttcgcgcaggacgaggcgagc
tgcatcgtgttcggcatgccgcgcgaggcgatcgcgctcggcggcgcggacgaagtcgcg
ccgctcgccgaaatgagccggcgcgtgatggcgcgactcgctacgatgggcgatcgcgtg
cagcgcgtctga

DBGET integrated database retrieval system