KEGG   Burkholderia vietnamiensis: Bcep1808_0294Help
Entry
Bcep1808_0294     CDS       T00493                                 

Definition
hypothetical protein
Organism
bvi  Burkholderia vietnamiensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(322906..324147)
Genome map
AA seq 413 aa AA seqDB search
MKRNLVLAAALAAPLLSACGGGSDNPPPLVEDRLCPASLDYSTVFTGGAGSGELAKVQLD
TTKMTWQVTYVESAVPQTTGTVTPTRAGTVDSGTLTQETMLPTNKLNQCAFRLNGASLDP
SRPARIFVGFGVAGGTIPGKEIQFNGVLGQAAVPDTKFPYYPFIGFSSIETDITKVAGTY
SHIGFGEVPSQKFAPASIDAKVTINADGTWTKCDTTGQFAGGACVQQGTNFVQSADGSGA
FQSNNYQSQLKPTLSATPQGKGFMIVGRLRNQLVPVLVRTGVANPNPTPDSNGVPGLTAD
DESSISILSPQTAIAAGSQNGEYIGVDSQFDYRTTALINNQATLLDPFQPSQASLATALD
LDYTQKVPGTVTTIHTGSGSTSPTGKFIFTGGVFGFLDNAGTTPYFTIGAFVQ
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcaacctcgttctggcggcggcccttgccgccccccttctttccgcatgcggc
ggcggcagcgacaacccgccgccgctcgtcgaagaccggctctgcccggcgtcgctcgac
tacagcaccgtcttcacgggcggcgcgggcagcggcgaactggccaaggtccagctcgac
acgaccaagatgacctggcaggtcacctacgtcgaatcggcggttccgcaaaccaccggc
accgtcacgccgacgcgcgccggcaccgtggacagcggcacgctcacgcaggaaacgatg
ttgccgaccaacaagctcaaccagtgcgcgttccgcctgaacggcgcgagcctcgatccg
tcgcggccggcgcgcatcttcgtcggcttcggcgtcgccggcggcacgattccgggcaag
gagatccagttcaacggcgtgctcggccaggccgcggtgcccgacacgaagttcccgtac
tacccgttcatcggtttctcgtcgatcgaaaccgacatcacgaaggtcgccggcacgtac
agccatatcggcttcggcgaagtgccgtcgcagaaattcgcgccggcgtcgatcgatgcg
aaggtgacgatcaacgccgacggcacgtggaccaaatgcgacacgaccggccagttcgcc
ggcggcgcgtgcgtgcagcagggcacgaacttcgtgcagtcggccgacggcagcggcgcg
ttccagagcaacaactaccagagccagttgaagccgacgctgtcggcgacgccgcagggc
aagggcttcatgatcgtaggcaggctgcgcaaccagctcgtgccggtgctcgtgcgcacg
ggcgtcgcgaacccgaacccgacgccggacagcaacggcgtgccgggcctcaccgccgac
gacgaatcgagcatctcgatcctgtcgccgcagacggcgatcgcggccggatcgcagaac
ggcgaatacatcggcgtcgacagccagttcgactaccgcaccaccgcgctgatcaacaac
caggccacgctgctcgatccgttccagccgtcgcaggcttcgctcgcgaccgcgctcgac
ctcgactacacgcagaaggtgccgggcacggtcacgacgatccacacgggctcgggcagc
acgtcgccgaccggcaagttcatcttcacgggcggcgtgttcggcttcctcgacaacgct
gggacgacgccgtatttcacgatcggcgcgttcgtccagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system