KEGG   Burkholderia vietnamiensis: Bcep1808_0418Help
Entry
Bcep1808_0418     CDS       T00493                                 

Definition
peptidase S1 and S6, chymotrypsin/Hap
Orthology
K04772  
serine protease DegQ [EC:3.4.21.-]
Organism
bvi  Burkholderia vietnamiensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(450279..451487)
Genome map
AA seq 402 aa AA seqDB search
MLRRFWLFFAQAVTVLLALMFIVVTLKPQWLQRQGQLGKQLATPIVALREVAPGIGGGPA
TTSYAEAAQKAMPAVVNVFSSKDGSLPPDPRAKDPLFRYFFGDRNNARKQQDEPAANLGS
GVIVSPEGYILTNQHVVDGADQIEVALADGRTATAKVIGSDPETDLAVLKINMTDLPTIT
LGRSDRSRVGDVVLAIGNPFGVGQTVTMGIISALGRNHLGINTFENFIQTDAPINPGNSG
GALVDVNGNLLGINTAIYSRSGGSLGIGFAIPVSTARTVLESIITTGSVTRGWIGVEPQD
VTPEIAESFGLQQKSGAIVAGVLQGGPADKAGIKPGDILVSVNGDDITDTTKLLNTVAQI
KPGTATKVHVVRKGKEFDVNVVIGKRPPPPKQTVDEQDSDSE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcttagacgcttctggctgttcttcgcgcaggcggtcaccgtactgctcgcgctgatg
ttcatcgtcgtgacgctcaagccgcaatggctgcaacggcaaggacagctcggcaagcag
ctcgccacgccgatcgtcgcgctgcgggaagttgcgccgggcatcggcggcggtccggcg
accacgtcgtacgcggaagccgcgcaaaaggcgatgcccgccgtcgtcaacgtgttctcc
agcaaggacggctcgttgccgcccgatccgcgcgcgaaggatccgctgttccgctatttc
ttcggcgatcgcaacaacgcccgcaagcagcaggacgaaccggccgccaacctcggctcc
ggcgttatcgtgagcccggaaggttacattctaacgaaccagcacgtcgtcgatggtgcc
gaccagatcgaagtcgcgctcgccgacggccgcacggccaccgcgaaggtgatcggcagc
gatccggaaaccgatctcgccgtgctgaagatcaacatgacggacctgccgaccatcacg
ctcggccgttcggaccgctcgcgcgtcggcgacgtcgtgctggcgatcggcaacccgttc
ggcgtcggccagacggtcacgatgggcatcatcagcgcgctcggccgcaatcacctcggc
atcaacacgttcgaaaacttcatccagaccgacgcgccgatcaaccccggcaactcgggc
ggcgcgctcgtcgacgtgaacggcaacctgctcggcatcaacaccgcgatctactcgcgc
tcgggcggctcgctcggcatcggcttcgcgatccccgtgtcgacggcccgcacggtgctc
gaaagcatcatcacgaccggctcggtcacgcgcggctggatcggcgtcgagccgcaggac
gtcacgccggagatcgccgaatcgttcgggctccagcagaagtcgggcgcgatcgtcgcg
ggcgtgctgcagggcggcccggccgacaaggccggcatcaagccgggcgacatcctggtc
agcgtgaacggcgacgacatcaccgacacgaccaagctgctgaataccgtcgcgcagatc
aagcccggcacggcgaccaaggtgcacgtggtgcgcaagggcaaggagttcgacgtgaac
gtcgtgatcggcaagcgcccgccgccgccgaagcagaccgtcgacgagcaggacagcgac
agcgaatga

DBGET integrated database retrieval system