KEGG   Burkholderia vietnamiensis: Bcep1808_0606Help
Entry
Bcep1808_0606     CDS       T00493                                 

Definition
guanine-specific ribonuclease N1 and T1
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bvi  Burkholderia vietnamiensis
Brite
Enzymes [BR:bvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     Bcep1808_0606
Transfer RNA biogenesis [BR:bvi03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    Bcep1808_0606
 Prokaryotic Type
    Bcep1808_0606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:664415..664846
Genome map
AA seq 143 aa AA seqDB search
MARKWLRNGALASVFAMFAMGIVGAPTGSLVSAAYARQAASADVAAAGVDTVPAARLPRE
AVTTLGLIADGGPYPYEKDGVVFGNRERILPKAKRGYYHEYTVPTPRARNRGARRIVCGG
PLRRTDNCYYTDDHYNSFKRIVE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagtggctccgcaacggcgcgctcgcgtccgtcttcgcgatgtttgcgatg
ggtatcgtcggcgcgccgacgggcagtctggtttccgccgcatacgcacggcaggccgct
tcggccgacgtggccgcagccggggtcgatacggtccccgcggcgcgtttgccgcgcgag
gccgtgaccacgcttggcctgatcgccgacggcggcccctatccttacgagaaggacggc
gtcgtgttcggcaatcgcgaacggatcctgcccaaggcgaagcgcggctactaccacgag
tacacggtcccgacgccgcgcgcgcgcaatcgcggcgcgcgtcggatcgtctgtggcggg
ccgctgcgccggaccgacaactgttattacacagacgaccactacaacagttttaaacgt
attgttgaatga

DBGET integrated database retrieval system