KEGG   Burkholderia vietnamiensis G4: Bcep1808_0807Help
Entry
Bcep1808_0807     CDS       T00493                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00521  Streptomycin biosynthesis
bvi00523  Polyketide sugar unit biosynthesis
bvi01130  Biosynthesis of antibiotics
Module
bvi_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Bcep1808_0807
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bcep1808_0807
Enzymes [BR:bvi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Bcep1808_0807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABO53819
JGI: Bcen18080807
UniProt: A4JC16
Position
1:885090..885641
Genome map
AA seq 183 aa AA seqDB search
MAIHVTATALPEVKLIEPKVFGDARGYFYESFNAREFAEHVAPGIEFVQDNHSRSAKGVL
RGLHYQIEHTQGKLVRVVEGEVFDVAVDVRRSSPNFGKWVGVSLSADNHRQLWVPPGFAH
GFLVVSESAQFLYKTTDYWFPEHERSIVWNDPDIGIAWPLDGEPLLAVKDAAGMRLMDAD
LFE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggcaatccacgtaacggcaacggcactgcccgaagtcaagcttatcgagccgaaagtc
ttcggcgacgcgcgcgggtatttctacgagagcttcaacgcgcgcgagtttgcggagcac
gtcgctccgggcatcgagttcgtgcaggacaatcactcgcgatccgcaaaaggcgtgctg
cgcgggctgcactaccagatcgaacacacacagggcaagctggtacgcgtggtcgaggga
gaggtgttcgacgtcgcagtcgatgtgcgccgcagttcgcccaatttcggcaagtgggtc
ggcgtgtcgctgtccgccgacaaccatcggcagctttgggttccgccggggttcgcgcat
ggcttccttgtggtgtccgagtctgctcagtttctctacaaaacgaccgattattggttt
cccgaacacgagcgcagcattgtctggaacgatccggacatcgggatcgcgtggccgctg
gatggcgagccgctgcttgccgtcaaggatgccgcgggcatgcggttgatggacgctgat
ctttttgagtga

DBGET integrated database retrieval system