KEGG   Burkholderia vietnamiensis: Bcep1808_0826Help
Entry
Bcep1808_0826     CDS       T00493                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep1808_0826
   00030 Pentose phosphate pathway
    Bcep1808_0826
   00051 Fructose and mannose metabolism
    Bcep1808_0826
   00052 Galactose metabolism
    Bcep1808_0826
   00500 Starch and sucrose metabolism
    Bcep1808_0826
   00520 Amino sugar and nucleotide sugar metabolism
    Bcep1808_0826
  Nucleotide metabolism
   00230 Purine metabolism
    Bcep1808_0826
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bcep1808_0826
Enzymes [BR:bvi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Bcep1808_0826
    5.4.2.8  phosphomannomutase
     Bcep1808_0826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:909509..910927
Genome map
AA seq 472 aa AA seqDB search
MHATERELMISQSIFKAYDIRGVVGKTLDADTARAIGRAFGSEVRAQGGDAVVVARDGRL
SGPELVGALADGLRAAGVDVVDVGMVPTPVGYFAASVPLALKGGERRVDSCIVVTGSHNP
PDYNGFKMVLRGAAIYGEQIQALYRRIVDERYDTGSGSYEAFDVADQYIARIVGDVKLAR
PLKLVVDAGNGVAGPLATRLFKALGCELVERFTDIDGTFPNHHPDPAHPENLQDVIQALK
DTDAELGFAFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRHLA
QWVKEKGGEPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLE
ILAKTADPSAVLNALPDAMSTPELQLKLEEGENFRLIEKLQSEAKFDGADEVVTIDGLRV
EYPDGFGLARSSNTTPVVVLRFEAETQEGLERIQADFRRVLTAAKPDVDLPF
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcaaccgagagagaactgatgatctcccaatccatcttcaaggcatatgacatt
cgcggcgtggtcggcaagacgctcgacgccgacacggcgcgcgccatcggccgcgcgttc
ggcagcgaagtgcgcgcgcaaggcggcgacgccgtcgtggtcgcgcgcgacggccgcctg
tccgggccggaactcgtcggcgcgctggccgatggcctgcgtgcggcgggcgtcgacgtc
gtcgacgtcggcatggtgcccacgccggtcggctatttcgcggcgagcgtgccgctcgcg
ctgaagggcggcgagcgccgcgtcgattcgtgcatcgtcgtcaccggcagccacaacccg
cccgactacaacggcttcaagatggtgctgcgcggcgcggcgatctacggcgagcagatc
caggcgctgtaccgccgcatcgtcgacgagcgctacgacaccggcagcggttcgtacgaa
gcattcgacgtggccgatcagtacatcgcgcgcatcgtcggcgacgtgaagctcgcgcgt
ccgctgaagctcgtcgtcgatgcgggcaacggcgttgccggcccgctcgcgacgcgtctg
ttcaaggcgctcggctgcgagctggtcgagcgcttcaccgacatcgacggcacgttcccg
aaccatcaccccgatcccgcgcacccggaaaacctgcaggacgtgatccaggcgctgaag
gacaccgacgcggaactcggcttcgcgttcgacggcgacggcgaccgcctgggcgtcgtc
acgaaggacggccagatcatctacccggaccgccagctgatgctgttcgcggaggaagtg
ctgtcgcgcaatccgggcgcgcagatcatctacgacgtgaagtgcacgcgccatctcgcg
cagtgggtgaaggagaagggcggcgagccgctgatgtggaagacgggccactcgctggtg
aaggcgaagctgcgcgagacgggcgcaccgctcgcgggcgagatgagcggccacgtgttc
ttcaaggatcgctggtacggcttcgacgacgggctgtacacgggcgcgcggctgctggag
atcctcgcgaagacggccgatccgagcgcggttctcaatgcgctgccggacgcgatgagc
acgccggaattgcaactcaagctcgaagaaggcgagaacttccgtctgatcgagaagctg
cagagcgaggcgaagttcgacggcgcggacgaggtcgtgacgatcgacgggctgcgcgtc
gagtatccggacggcttcggcctcgcgcgctcgtcgaacacgacgccggtggtcgtgctg
cgcttcgaggcggagacgcaggaagggctcgagcgtatccaggcggatttccgccgcgtg
ctgacggctgcgaagccggacgtcgatctgccgttctga

DBGET integrated database retrieval system