KEGG   Burkholderia vietnamiensis G4: Bcep1808_0843Help
Entry
Bcep1808_0843     CDS       T00493                                 

Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bvi  Burkholderia vietnamiensis G4
Brite
Enzymes [BR:bvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Bcep1808_0843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:complement(926584..927240)
Genome map
AA seq 218 aa AA seqDB search
MNIENARFNMIEQQIRPWDVLDLDVLGLLSIVKRENYVLPEHRDLAFADLELPLPGGTSK
MLFPRVEARVLQELAVKKHENVLVIGAGSGYLAALFAHRAQHVTAVDIDPTIAKFAADNL
RNDGVTNAEVVLGDGSLGWPAKAPYDVICVAGGLPVVPQQMLEQLKVGGRLSAFVGGRPV
MKAQIITRIDDKQYRVADVFETYVNHLVNAIEPSRFKF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgaaaacgcgcgtttcaacatgatcgaacaacagatccggccgtgggacgtg
ctggacctggacgtcctgggcctgctgtcgatcgtcaagcgagaaaactacgttctgccc
gaacaccgcgatctggcgttcgccgatctcgagctgccgctgccgggcggcaccagcaag
atgctgttcccgcgcgtcgaagcgcgcgtgctgcaggagctggcggtcaagaagcacgag
aacgtcctcgtgatcggtgcgggctccggctacctggccgcgctgttcgcgcatcgcgcg
cagcacgtgacggcggtcgacatcgatccgacgatcgcgaagttcgcagccgacaacctg
cgcaacgacggcgtgacgaacgccgaagtcgtgctcggcgacggctcgctcggctggccc
gccaaggcgccgtacgacgtgatctgcgtcgcgggcggcctgccggtcgtgccgcagcag
atgctcgaacagctgaaggtcggcggccgcctgtcggcattcgtcggcggccgtccggtg
atgaaggcgcagatcatcacgcgtatcgacgacaagcagtaccgcgtcgccgacgtgttc
gaaacctacgtgaaccacctcgtgaacgcgatcgagccgtcgcgcttcaagttctga

DBGET integrated database retrieval system