KEGG   Burkholderia vietnamiensis: Bcep1808_0904Help
Entry
Bcep1808_0904     CDS       T00493                                 

Definition
Cl-channel, voltage-gated family protein
Organism
bvi  Burkholderia vietnamiensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(984716..986353)
Genome map
AA seq 545 aa AA seqDB search
MASESSYNAPLPCRPTPMQRSELPAPLSRLFPLLTRRSLRIWRQFGVFWLGAIAVGLAAV
LYARLIDWGYDTFRTMREHAAWLPLLLTPSIAAASAWITRRFFRGAEGSGIPQVIATLHA
SPRAFGSRLLTLRILFGKVLVSFLGILGGFTIGREGPTVQVGAALMFNLRRLYPRSNAQI
ERQLVLAGAAAGLSAAFNTPLAGIVFAIEELTRSFSARASGVLITAIILAGVVALGVNGN
YTYFGTINAGQHFPKMLAVAVLVTAIVTGIAGGLFSWLLLNTGRWLPARLLVLYRERPIA
FAALCGFVIAVVGIVSGGTTFGSGYAEARGLLDGHEQLSVFYPFLKMVSMVGSYLPGIPG
GIFAPSLSIGAGFGNLLHLAFGNMSLPMLIALAMVGYLAAVTQSPITSFVIVMEMINGHA
LVISLMATALVSSRIARFFAPPLYETLAERYLAPPAAAPSATAPAAAAAAAAATAASGVT
EPQDAPADPLDTLREEDGDAEVATQAQSPSSGSAPAAGHDAAHASAARPDADSPASTAAD
PRDPQ
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgaatcttcctataatgcgcctttgccctgccggccgacgccgatgcaacgc
tcagagcttcccgccccgctttcccgtctgtttccgctcctcacccgacgctcgctgcga
atctggcgccagttcggcgtcttctggctcggcgccatcgccgtcggtctcgcggccgtg
ctgtacgcgcggctgatcgactggggttacgacacgttccgcacgatgcgcgagcacgcc
gcctggctgccgctgctactgacgccgtcgatcgccgcggcgtccgcgtggatcacccgc
cgcttcttccgcggcgccgagggcagcgggattccgcaagtcatcgcgacgctgcatgcg
agcccgcgcgcattcggctcgcggctgctgacgctgcgcatcctgttcggcaaggtgctg
gtttcgttcctggggatcctgggcggcttcacgatcggccgcgagggcccgaccgtgcag
gtcggcgccgcgctgatgttcaacctgcggcgcctctatccgcgctcgaacgcacaaatc
gaacggcagctggtgctcgccggcgcggcggccggcctgtccgcggcgttcaacacgccg
ctcgccggtatcgtgttcgcgatcgaggaactcacgcgcagcttctccgcgcgcgcaagc
ggcgtgctgatcaccgcgatcatcctcgccggcgtcgtcgcgttgggcgtgaacggcaac
tacacgtacttcggcacgatcaacgccggccagcatttcccgaagatgctggcggtcgcc
gtgctcgtcaccgcgatcgtgacgggcatcgccggcggcctgttcagctggctgctgctc
aacaccggacgctggctgcccgcgcgcctgctcgtgctgtatcgcgagcgcccgatcgcg
ttcgccgcgctgtgcgggttcgtgatcgccgtcgtgggcatcgtgtcgggcggcacgacg
ttcggcagcggctatgccgaggcacgcgggctgctcgacggccacgagcagctgtcggtg
ttctatccgtttctgaagatggtgtcgatggtcgggtcgtacctgcccggcatcccgggc
gggatcttcgcgccgtcgctgtcgatcggcgcggggttcggcaacctgctgcacctcgcg
ttcggcaacatgagcctgccgatgctgatcgcgctcgcgatggtcggctacctcgcggcg
gtcacgcaatcgccgatcacgtcgttcgtgatcgtgatggagatgatcaacggccacgcg
ctcgtgatttcgctgatggcgaccgcgctggtgtcgagccgcatcgcgcgcttcttcgcc
ccgccgctctatgaaacgctcgcggagcgctatctcgcgccgccggccgccgcaccgtcc
gctacggcaccagcggcggctgccgctgccgcggcggctacggccgcgagcggcgtcacg
gagccgcaggatgcgccagccgatccgctcgacacgctgcgcgaagaagacggcgacgca
gaggtcgcgacgcaggcgcaatcgccgtcatccggatcggcacccgcagccggccacgac
gcagcgcacgcctctgcggcacggcccgatgccgactcgccggcgtcgacggcagccgac
ccgcgcgaccctcagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system