KEGG   Burkholderia vietnamiensis G4: Bcep1808_0916Help
Entry
Bcep1808_0916     CDS       T00493                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00230  Purine metabolism
bvi01100  Metabolic pathways
Module
bvi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Bcep1808_0916
Enzymes [BR:bvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Bcep1808_0916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 MMR_HSR1 RsgA_GTPase ABC_tran AAA_16 AAA_29 AAA_22 Septin AAA_25 AAA_23 Viral_helicase1
Motif
Other DBs
NCBI-ProteinID: ABO53927
JGI: Bcen18080916
UniProt: A4JCC4
Position
1:996159..996842
Genome map
AA seq 227 aa AA seqDB search
MTDSHRDGHASHALHGGVYPGNLFMVIAPSGAGKSTLVNALLSKDSDICLSISYTTRKPR
PGEQDGQHYHFTTVEDFRARHAAHEFLESAEVHGNYYGTSRVWIEEQMASGHDVLLEIDW
QGAQQVKRQFHNAVGIFILPPSLDALEERLKKRGQDEPNVITRRLLAAGSEMAHASEAEY
VVINENFDRALAELECIVAATRLRFGSQYARHAELFIELGIHLPHAE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcccatcgcgacggccacgcgtcgcatgcgctgcacggcggcgtctatccc
ggcaacctgttcatggtcatcgcgccgtcgggcgccggcaagtcgacgctcgtgaacgcg
ctgctgtcgaaggacagcgacatctgcctgtcgatttcgtacacgacgcgcaagccgcgc
ccgggcgagcaggacggccagcactatcacttcaccaccgtcgaggatttccgcgcgcgt
cacgccgcgcacgaattcctcgaaagcgcggaagtgcacggcaactactacggcacgtcg
cgcgtgtggatcgaggagcagatggcgagcggccacgacgtgctgctcgagatcgactgg
cagggcgcgcagcaggtgaagcggcagtttcacaacgcggtcggcatcttcatcctgccg
ccatcgctcgatgcgctcgaggagcgtctgaagaagcgcggccaggacgagccgaacgtc
atcacgcgacgcctgctcgcggcaggcagcgagatggcgcacgcgtccgaagcggaatac
gtggtgatcaacgagaatttcgatcgtgcgctcgcggaactggagtgcatcgtcgcggcg
acgcgcctgcgttttggttcgcagtacgcgcgacatgcggagctgttcatcgaactcggc
atccatctgccccacgcggaatga

DBGET integrated database retrieval system