KEGG   Burkholderia vietnamiensis: Bcep1808_1058Help
Entry
Bcep1808_1058     CDS       T00493                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bvi  Burkholderia vietnamiensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bcep1808_1058
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Bcep1808_1058
Enzymes [BR:bvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bcep1808_1058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1142157..1143185
Genome map
AA seq 342 aa AA seqDB search
MKTTPGPVMLDVVGTALSRDDARRLAHPNTGGVILFARHFENRAQLSALTDSIRAVREDI
LIAVDHEGGRVQRFRTDGFTVLPAMRRLGDLWDRDVLLATKVATAVGYILAAELRACGID
MSFTPVLDLDYGHSKVIGDRAFHRDPRVVTLLAKSLNHGLSLAGMANCGKHFPGHGFAEA
DSHVALPTDDRPLDAILEGDVAPYDWLGLSLSAVIPAHVIYTQVDPRPAGFSRVWLQDIL
RGRLGFTGAIFSDDLSMEAAREGGTLTQAADAALAAGCDMVLVCNQPEAAEVVLNELSAR
PSPESVRRIKRMRARGKALKWDKLIAQPEYLQARGLLTSVLA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgactcccggcccggtcatgctcgacgtcgtcggcacggccctgtcgcgcgac
gatgcgcggcgccttgcgcatccgaacaccggcggcgtgatcctgttcgcgcggcatttc
gaaaaccgcgcgcagctgagcgcgttgaccgactcgatccgcgcggtgcgcgaggacatc
ctgatcgcggtcgatcacgaaggcggccgcgtccagcggttccgcaccgacggcttcaca
gtgctgccggcgatgcgccggctcggcgatctgtgggatcgcgacgtgctgctcgcgacc
aaggtcgccaccgcggtcggctacatcctcgccgccgagctgcgcgcctgcgggatcgac
atgagcttcacgcccgtgctcgatctcgactacggacattcgaaggtgatcggcgatcgc
gcgttccatcgcgacccgcgcgtcgtcacgttgctcgcgaagagcctgaaccacgggctg
tcgctcgcgggcatggccaactgcggcaagcatttccccgggcatggtttcgcggaagcc
gattcgcacgtcgcgctgccgaccgacgaccggccgctcgacgcgatcctcgagggagac
gtcgcgccgtacgactggctcggcctgtcgctgtcggcggtgattcccgcgcacgtgatc
tatacgcaggtcgacccgcggcccgccggcttctcgcgcgtgtggctgcaggacatcctg
cgcgggcggctcggtttcacgggcgcgatcttcagcgacgacctgtcgatggaggccgcc
cgcgaaggcggcacgctcacgcaggccgccgacgcggcgctcgcggccggctgcgacatg
gtgctcgtctgcaaccagccggaggccgccgaagtcgtgctgaacgaactgagcgcgcgg
ccgtcgccggagtcggtgcggcgcatcaagcggatgcgtgcgcgcggcaaggcgctcaag
tgggacaagctgatcgcgcagcccgagtatctgcaggcgcgcgggctgttgaccagcgtg
ctcgcataa

DBGET integrated database retrieval system