KEGG   Burkholderia vietnamiensis: Bcep1808_1115Help
Entry
Bcep1808_1115     CDS       T00493                                 

Definition
phosphatase-like protein
Orthology
K07093  
 
Organism
bvi  Burkholderia vietnamiensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1212609..1214564)
Genome map
AA seq 651 aa AA seqDB search
MPALPNASRRQALKILAGAPMLPLSGLALPALLTGCGGDDNPTATPAAAYTSAAFAAMAA
PTLDNPGAMAATTVGSTLAVSFSDGSSRNFKLAYRPFFVTGDMVPDGKGGTILAGGYYDI
NNQPIIDRSVAGKERQFYSDCPDGSSLLTLKNANVAGVKGNTVFAVVQFEYTTRDQASAS
QYGQLPSPIAVITLDQDPATGALKVVKYHNVDTSKAHGLWITCGASLSPWGTHLSSEEYE
PDATKAATDAQFKAFSRNTFGDETKANPYHYGHLPEITVNPDGTGTVKKHYCLGRISHEL
IQVMPDQRTVMMGDDATNGGLFMFVADKAADLSAGTLYVAKWTQTTSAGAGSATLTWIRI
GHATSSEIETLANTLKASDIMDVATVDPADASYTKIHFGGKFNWIRVKPGMEKAAAFLET
HRYAALIGGSMAFTKLEGTTVNARDKIVYSAMSRIETSMIKGNAVSRDVALDKKIAAGAV
YALNLKGSQRDTTGAAIDSDWVPVDMSAPAALVGEDLAAADALGNLANPDKIANPDNLKF
SEKLRTLFIGEDSGMHVNNFLWAYNVDTKVLTRVLSCPAGAESTGLHAVDEINGWTYIMS
NFQHAGDWETPLHDKVKPTLDPLVRANFKDRFGASVGYLTAEPTSIKLAKA
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgttgcccaatgcttcccgtcgtcaggccctgaagatcctcgccggggcgccg
atgctgcccctttccggcctcgcgctgccggccctgttgaccggctgcggcggcgacgac
aatccgacggccacgccggccgccgcctatacgtcggccgcgttcgcggcgatggccgcg
ccgacgctcgacaatccgggcgcgatggccgccacgacggtgggctcgacgctggcggtg
tcgttctcggacggctcgtcgcgcaacttcaagctcgcgtaccggccgttcttcgtgacg
ggcgacatggtgccggacggcaaaggcggcacgatcctcgcgggcggctactacgacatc
aacaaccagccgatcatcgaccgctcggtggccggcaaggagcgccagttctattcggac
tgtccggacggcagctcgctgctcacgctgaagaacgcgaacgtggcgggcgtgaaaggc
aacacggtgttcgccgtcgtgcagttcgaatacacgacgcgcgaccaggcgagcgcgtcg
cagtacggccagctgccgtcgccgatcgcggtcatcacgctcgaccaggatcctgccacc
ggcgcgctgaaggtcgtcaagtatcacaacgtcgacacgtcgaaggcgcacgggctgtgg
atcacctgcggcgcgagcctgtcgccgtggggcacgcacctgtcgagcgaggaatacgag
ccggacgcgacgaaggccgcgaccgacgcgcagttcaaggcgttcagccgcaacacgttc
ggcgacgagacgaaggcgaacccctaccactacggccatctgcccgagatcacggtgaat
ccggacggcaccggcacggtgaagaagcactactgtctcggccgcatctcgcacgagctg
atccaggtgatgccggaccagcgcaccgtgatgatgggcgacgacgcgaccaacggcggc
ctgttcatgttcgtcgccgacaaggcggccgacctgtcggccggcacgctgtacgtcgca
aaatggacgcagacgacctcggccggcgccggcagcgcgacgctcacgtggatcaggatc
ggccatgcgacgagcagcgagatcgagacgctcgcgaacacgctgaaggcgtcggacatc
atggacgtcgcgacggtcgatccggccgacgcgagctatacgaagatccacttcggcggc
aagttcaactggattcgcgtgaagccggggatggaaaaggccgccgcgttcctggagacg
caccgctacgcggcgctgatcggcggcagcatggcgttcacgaagctcgagggcacgacg
gtcaacgcgcgcgacaagatcgtctactcggcgatgtcgcggatcgagacgtcgatgatc
aagggcaacgcggtgtcgcgcgacgtcgcgctcgacaagaagatcgccgcgggcgccgtc
tacgcgctgaacctgaagggcagccagcgcgacacgacgggcgccgcgatcgacagcgac
tgggtgccggtcgacatgagcgcgccggccgcgctggtcggtgaggacctggccgccgcc
gacgcgctcggcaacctcgcgaacccggacaagatcgcgaaccccgacaacctgaagttc
tcggaaaagctgcgcacgctcttcatcggcgaagactcgggcatgcacgtgaacaacttc
ctgtgggcgtacaacgtcgacacgaaagtgctcacgcgcgtgctgtcgtgcccggcgggc
gccgaatcgacgggcctgcacgcggtggacgagatcaacggctggacctacatcatgagc
aacttccagcacgcgggcgactgggaaacgccgctgcacgacaaggtcaagccgacgctc
gatccgctcgtgcgcgcgaacttcaaggaccgcttcggcgcaagcgtcggctatctgacg
gccgagccgaccagcatcaagctcgcgaaggcctga

DBGET integrated database retrieval system