KEGG   Burkholderia vietnamiensis: Bcep1808_1366Help
Entry
Bcep1808_1366     CDS       T00493                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bvi  Burkholderia vietnamiensis
Brite
Enzymes [BR:bvi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Bcep1808_1366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1461559..1462920
Genome map
AA seq 453 aa AA seqDB search
MHSLPNSRASARSLLPAMAALLAAGALAALAGCDARPAATAAVTAVISAAQAAPAAPTLA
PAVAPPNQPQSRAQVFEGVKQMTALGKQLFFDPSLSGSGKLACASCHSPDHAFGPPNALS
VQLGGDDMHRTGFRAAPSLKYLRGIPPFSEHFHDSPDEGDESIDAGPTGGLTWDGRVDTR
DAQARIPLTSPFEMSSSPKRVAQAVRAAPYADAFRRAFGDPVLADDQATFAAVLRALDAF
QQQPALFDPYTSKYDAYLAGHAKLTPAELHGLQLFNDERKGNCASCHVSQRTLEGGPPQF
SDFGLIAIAVPRNRALAVNRDARFHDLGACGPQRTDLKGRDEFCGLFRTPSLRNVALRKT
FFHNGVYHSLDDVLRFYAERDIHPEKFYPVVHGKVQIYDDLPKRYWPNINREPPFDRKRG
DAPALNAAEIKDVIAFLNTLTDGYQPAADHAAR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcacagccttccgaactcccgcgcgtcagcgcgatcgttgctgccggccatggcggcg
ctgctcgcggccggcgcgctcgccgccctggccgggtgcgacgcgcggcccgccgcgact
gccgcggtcacagcggtcatttccgccgcccaggccgcgccggccgcgccgacgctcgca
ccggcggtcgcgccgcccaatcagccgcagagccgcgcgcaggtgttcgagggcgtgaag
cagatgacggcgctcggcaagcagctgttcttcgatccgtcgctgtcgggctcgggcaag
ctcgcgtgcgcgtcgtgccacagccccgaccatgcgttcgggccgccgaacgcgctgtcg
gtgcagctcggcggcgacgacatgcatcgcaccggttttcgcgcggcgccgtcgctgaag
tacctgcgcgggatcccgccgttcagcgagcacttccacgattcgccggacgaaggcgac
gagagcatcgacgcggggccgacgggcggcctgacgtgggacggccgcgtcgatacgcgc
gatgcgcaggcgcgcatcccgctcacgtcgccgttcgagatgagcagctcgcccaagcgc
gtcgcgcaggccgtgcgcgcggcgccgtatgcggacgcgttccgccgcgcgttcggcgac
ccggtgctcgccgacgatcaggcgaccttcgccgcggtgctgcgcgcgctcgacgcgttc
cagcagcagccggcgctgttcgatccgtacacgagcaagtacgacgcgtatctggccggc
catgcgaagctcacgccggccgaactgcacggcttgcagctgttcaacgacgagcgcaag
ggcaactgcgcgagctgtcacgtgagccagcgcacgctcgaaggcgggccgccgcaattc
agcgatttcgggctgatcgcgatcgcggtgccgcgcaaccgcgcgctggccgtcaatcgc
gacgcgcgcttccacgatctcggcgcgtgcgggccacagcgcaccgacctgaagggtcgc
gacgaattctgcgggctgttccgcacgccgtcgctgcgcaacgtggcgttgcgcaagacc
ttcttccacaacggcgtgtaccactcgctcgacgacgtgctgcgcttctacgcggagcgc
gacatccatccggagaagttctatccggtcgtgcacggcaaggtgcagatctacgacgac
ctgccgaaacgctactggccgaacatcaaccgcgagccgccgttcgaccgcaagcgcggc
gacgcgcccgcgctgaacgccgccgagatcaaggatgtgatcgcgttcctgaacacgctg
accgacggatatcaacctgcggccgatcacgcggcgcgctga

DBGET integrated database retrieval system