KEGG   Burkholderia vietnamiensis: Bcep1808_1423Help
Entry
Bcep1808_1423     CDS       T00493                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bcep1808_1423
Enzymes [BR:bvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Bcep1808_1423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1530406..1531335
Genome map
AA seq 309 aa AA seqDB search
MKDHAEFPRIAVVGSLNVDLVTHAPRLPVPGETLLGTAFRTVSGGKGANQAVAAARLGAS
VAMIGCVGNDAFGARLHDALAAERIDLTHVHRIDGAATGVATIAVDASGANSIVVVPGAN
ARLDAATIDAARDAIAGAALMVCQLEVPMETVVRAIDRARACGTPVLLNPAPARPLSDAL
LARLEYLVVNETEAESLTGITVGDDASAVRAADALHAKGAGNVLVTLGARGVCWRGSAGN
GRHPALAVTAVDTTAAGDTFVGGFAAARAGGASMDDAIAFGQRAAAISVTRHGAQTSIPT
REEVQHTTA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaccacgctgaattccccaggatcgcggtcgtcggcagcctcaacgtcgacctc
gttacgcacgcgccgcggctgcccgtgccgggcgaaacgctgctcggcaccgcgtttcgg
acggtctccggcggcaagggcgcgaatcaggcggtggcggccgcgcgcctgggcgcctcg
gtcgcgatgatcggttgcgtcggcaacgatgcgttcggcgcgcgcctgcacgacgcgctt
gcggcagaacgcatcgacctgacgcacgtacaccggatcgacggcgcagcaaccggcgtc
gcgacgatcgcggtcgatgcgagcggggcgaacagtatcgtcgtcgtgcccggtgcgaac
gcgcgcctcgatgccgcaacgatcgacgcggcgcgcgacgcgatcgccggcgcggcgctg
atggtgtgccagctcgaggtgccgatggaaaccgtggtgcgcgcgatcgaccgtgcgcgc
gcctgcggcacgccggtgctgctcaatcctgcgcccgcgcggccgctgtccgacgcgttg
ctggcgcggctcgagtacctcgtcgtcaacgaaacggaagcggagtcgctgaccggcatc
acggtcggcgacgacgcctcggcagtgcgcgccgcagacgcattgcacgcgaagggcgcc
ggcaatgtgctggtcacgctcggcgcgcgcggcgtctgctggcgcggcagcgcgggcaac
ggccgccacccggcgctggcagtgacggccgtcgatacgacggcggccggcgacacgttc
gtcggcgggttcgcggccgcccgggcgggcggtgcgtcaatggacgatgccatcgcgttc
ggccagcgggctgccgcgatcagcgtcacgcgccacggcgcgcagacgtcgattccgacc
cgcgaggaagtgcagcacacgaccgcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system