KEGG   Burkholderia vietnamiensis: Bcep1808_1475Help
Entry
Bcep1808_1475     CDS       T00493                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:bvi01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bvi00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bvi00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1588500..1589777
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQVIATIDTEAKAGAAQAAAGAAEVQPAAAPAAAAPAAQPAAATASSSAA
ASPAAAKLLAEKGLSTGDVAGSGRDGRVTKGDALAAGSAPKAAPAAAPAKTAAAKPSLPE
VKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKY
KDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP
PQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPAR
LLLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttcggagtcggtttcggaagccaccatg
ctgcagtggaagaagaagccgggcgaagcagtcgcgcaggacgaaatcctgatcgaactc
gagaccgacaaggtcgtgctcgaagtgccggcaccggccgcgggcgtgctcgcgcaagtg
ctgcagaacgacggtgacaccgtggtagccgatcaagtgatcgcgacgatcgacaccgaa
gcgaaggcaggtgctgcgcaagccgcagcgggcgccgcggaagtgcagccggcggcagcg
ccggccgcagcagcaccggccgcacagccggctgccgcaacggcatcgagctcggccgcc
gcatcgccggccgcagcgaagctgctggccgagaagggtctgtcgacgggcgacgtcgca
ggctcgggccgcgacggccgcgtcacgaagggcgacgcgctcgccgcaggcagcgcaccg
aaggctgcaccggccgccgcaccggcgaagaccgccgctgcgaagccgtcgctgccggaa
gtgaaggtcccggcatcggccacgacctggctgaacgaccgtccggaacagcgcgtgccg
atgtcgcgcctgcgcgcgcgtatcgccgagcgtctgctcgagtcgcagcaaacgaacgcg
atcctgacgacgttcaacgaagtcaacatgcagccggtcatggacctgcgcgcgaagtac
aaggacaagttcgagaaggaacatggcgtgaagctcggcttcatgtcgttcttcgtgaag
gcggccgtgcacgcgctgaagaagttcccgctggtgaacgcgtcgatcgacggtaacgac
atcgtctaccacggctacttcgacatcggtatcgcggtcggttcgccgcgcggcctggtc
gtgccgatcctgcgcaacgcggatcagctgagcctcgccgagatcgagaagaagatcgcc
gaattcggccagaaggcgaaggacggcaagctgtcgatcgaggaaatgacgggcggtacg
ttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgacgccgatcatcaacccg
ccgcagtcggcgatcctcggcgtgcacgcgacgaaggaacgtccggtcgtcgagaacggc
cagatcgtgatccgtccgatcaactatctcgcgctgtcgtacgaccaccgcatcatcgac
ggccgcgaagccgttctgtcgctcgtcgcgatgaaggatgcgctcgaagatccggcacgt
ctgctgctcgacctgtaa

DBGET integrated database retrieval system