KEGG   Burkholderia vietnamiensis: Bcep1808_1736Help
Entry
Bcep1808_1736     CDS       T00493                                 

Definition
Pyrrolo-quinoline quinone
Orthology
K17713  
outer membrane protein assembly factor BamB
Organism
bvi  Burkholderia vietnamiensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1889826..1890971)
Genome map
AA seq 381 aa AA seqDB search
MNLLKRYAVPVACAAAVLALAACSSSKDARRVPTPLTEFKPVLDVQQVWKASVGKGGRYL
FSPVAVGDAVYAAGENGSVEKIDAKTGQTVWRGKVGSDLSAGVGSDGNLTAVGALKGGVF
VLGPDGKLLWKTTVQGEVFSPPLVGNGLVIVRTIDGQVIAFNAQTGEQKWNYRNRAVPLN
LRVSAGMTFAGDAAVLAGFPGGGLVALNLQTGEPFWQTPVSFPKGVTEVERINDVSGPPT
LVGAQACAVTFQGQIGCFDANSGRPVWEKPFSSRSGLAQDDSVVAAGDDWSVVTAYDAAS
GNPLWRNDKLKSRDVGVPYLLGHAVVMGDYKGFVHFLSREDGSFIARMKTDGSAITAAPV
LAGNTLVVQTQDGGLYGFRPR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgctgaaacgttacgctgtgcccgtagcctgcgcggcggctgtcctggcattg
gcggcctgctcgtcgtcgaaggacgcgcgccgcgtgccgacgcccctcaccgagttcaag
cccgtcctcgacgtgcaacaggtctggaaggcgagcgtcggcaagggcggacgctacctg
ttctcgccggtggccgtgggcgacgccgtctacgcggcgggtgagaacggttcggtcgag
aagatcgacgcgaagacgggccagacggtgtggcgcgggaaggtcggttcggacctgtcg
gccggtgtcggcagcgacggcaacctgaccgcggtcggcgcgctgaagggcggcgtgttc
gtgctcggccccgacggcaagttgctgtggaagaccaccgtgcagggcgaggtcttctcg
ccgccgctggtcggcaacggcctcgtgatcgtgcgcacgatcgacggccaggtgatcgcg
ttcaacgcgcagaccggcgagcagaagtggaattaccgcaaccgcgcggtgccgctgaac
ctgcgcgtgtcggccggcatgacgttcgccggcgatgcggccgtgctggccggcttcccc
ggcggcggcctggttgcgctgaacctgcagacgggcgagccgttctggcagacgcccgtg
tcgttcccgaagggggtgaccgaggtcgagcgcatcaacgacgtcagcggtccgccgacg
ctcgtgggcgcgcaggcatgcgcggtcacgttccaggggcagatcggctgcttcgacgcg
aactcgggccgtccggtgtgggaaaagccgttctcgagccgcagcggtctcgcgcaggac
gattcggtcgtggccgccggcgacgactggtcggtcgtgaccgcgtacgacgcggcgagc
ggcaacccgctctggcgtaacgacaagctgaagagccgcgacgtcggcgtaccttacctg
ctcggccatgcggtcgtgatgggcgactacaagggcttcgtgcacttcctgtcgcgcgag
gacggcagcttcatcgcgcggatgaagaccgacggcagcgcgatcactgcggcgccggtg
cttgccggcaacacgctggtcgtgcagacccaggacggcggcctgtacgggttccgcccg
cgctga

DBGET integrated database retrieval system