KEGG   Burkholderia vietnamiensis G4: Bcep1808_1736Help
Entry
Bcep1808_1736     CDS       T00493                                 

Definition
(GenBank) Pyrrolo-quinoline quinone
  KO
K17713  
outer membrane protein assembly factor BamB
Organism
bvi  Burkholderia vietnamiensis G4
Brite
Transporters [BR:bvi02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bcep1808_1736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:complement(1889826..1890971)
Genome map
AA seq 381 aa AA seqDB search
MNLLKRYAVPVACAAAVLALAACSSSKDARRVPTPLTEFKPVLDVQQVWKASVGKGGRYL
FSPVAVGDAVYAAGENGSVEKIDAKTGQTVWRGKVGSDLSAGVGSDGNLTAVGALKGGVF
VLGPDGKLLWKTTVQGEVFSPPLVGNGLVIVRTIDGQVIAFNAQTGEQKWNYRNRAVPLN
LRVSAGMTFAGDAAVLAGFPGGGLVALNLQTGEPFWQTPVSFPKGVTEVERINDVSGPPT
LVGAQACAVTFQGQIGCFDANSGRPVWEKPFSSRSGLAQDDSVVAAGDDWSVVTAYDAAS
GNPLWRNDKLKSRDVGVPYLLGHAVVMGDYKGFVHFLSREDGSFIARMKTDGSAITAAPV
LAGNTLVVQTQDGGLYGFRPR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgctgaaacgttacgctgtgcccgtagcctgcgcggcggctgtcctggcattg
gcggcctgctcgtcgtcgaaggacgcgcgccgcgtgccgacgcccctcaccgagttcaag
cccgtcctcgacgtgcaacaggtctggaaggcgagcgtcggcaagggcggacgctacctg
ttctcgccggtggccgtgggcgacgccgtctacgcggcgggtgagaacggttcggtcgag
aagatcgacgcgaagacgggccagacggtgtggcgcgggaaggtcggttcggacctgtcg
gccggtgtcggcagcgacggcaacctgaccgcggtcggcgcgctgaagggcggcgtgttc
gtgctcggccccgacggcaagttgctgtggaagaccaccgtgcagggcgaggtcttctcg
ccgccgctggtcggcaacggcctcgtgatcgtgcgcacgatcgacggccaggtgatcgcg
ttcaacgcgcagaccggcgagcagaagtggaattaccgcaaccgcgcggtgccgctgaac
ctgcgcgtgtcggccggcatgacgttcgccggcgatgcggccgtgctggccggcttcccc
ggcggcggcctggttgcgctgaacctgcagacgggcgagccgttctggcagacgcccgtg
tcgttcccgaagggggtgaccgaggtcgagcgcatcaacgacgtcagcggtccgccgacg
ctcgtgggcgcgcaggcatgcgcggtcacgttccaggggcagatcggctgcttcgacgcg
aactcgggccgtccggtgtgggaaaagccgttctcgagccgcagcggtctcgcgcaggac
gattcggtcgtggccgccggcgacgactggtcggtcgtgaccgcgtacgacgcggcgagc
ggcaacccgctctggcgtaacgacaagctgaagagccgcgacgtcggcgtaccttacctg
ctcggccatgcggtcgtgatgggcgactacaagggcttcgtgcacttcctgtcgcgcgag
gacggcagcttcatcgcgcggatgaagaccgacggcagcgcgatcactgcggcgccggtg
cttgccggcaacacgctggtcgtgcagacccaggacggcggcctgtacgggttccgcccg
cgctga

DBGET integrated database retrieval system