KEGG   Burkholderia vietnamiensis G4: Bcep1808_1752Help
Entry
Bcep1808_1752     CDS       T00493                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bcep1808_1752
DNA repair and recombination proteins [BR:bvi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Bcep1808_1752
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Bcep1808_1752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:complement(1906695..1907291)
Genome map
AA seq 198 aa AA seqDB search
MKQPSALSSLVEALRALPGVGPKSAQRIAYHLMQHDREGAERLGRSLLFATEHLQHCEKC
NTFTEAQICEVCSDDERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDGIGPK
EIHFDRLVRRASDGVVKEVVLATNFTNEGEATAHYLGQTLKARGLAVTRLARGVPVGGEL
EYVDAGTIARAMLDRRTM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagccgtccgccctgtcctcgctcgtcgaagcgctgcgcgcgctgcccggcgtc
gggccgaagtccgcgcagcgcatcgcgtatcacctgatgcagcacgatcgggagggcgcc
gagcggctcggccggtcgctgctgttcgcgaccgagcacctgcagcactgcgagaagtgc
aacacgttcaccgaggcgcagatctgcgaggtgtgcagcgacgacgagcgtgatccgacg
ctgctgtgcgtcgtcgagacgcccgccgaccagatcatgctcgagcagacgatgacgtac
cgcgggctgtacttcgtactgatggggcgactgagcccgctcgacgggatcggcccgaaa
gaaatccacttcgaccgcctcgtgcggcgcgcgtccgacggcgtcgtcaaggaggtcgtg
ctcgcgaccaacttcacgaacgaaggcgaagcgaccgcccattacctcggccagacgctg
aaggcgcgcgggctcgcggtcacgcgcctcgcacgcggcgtgccggtgggcggcgagctc
gaatacgtcgacgcgggcaccatcgcccgcgcgatgctcgaccgccgcacgatgtag

DBGET integrated database retrieval system