KEGG   Burkholderia vietnamiensis: Bcep1808_1773Help
Entry
Bcep1808_1773     CDS       T00493                                 

Definition
hypothetical protein
Organism
bvi  Burkholderia vietnamiensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1930100..1930531
Genome map
AA seq 143 aa AA seqDB search
MGLLDIVGGLIGGQAGGNSQSALIATALEFINNQPGGLNGLIEKFKAGGAGEVIGSWVGT
GENQPISADTLQNVLGSDVVGSLASKVGIDPSQASSILAQVLPHVVNGATPNGEVPAGGQ
IDTSNVLGTLTQLAGMFGGNKQG
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgggtctcctcgacatcgtcggcggtctgatcggcggccaggccggcggcaactcgcaa
agcgcgctcatcgcgaccgcgctcgaattcatcaacaaccagccgggcggcctgaacggg
ctgatcgagaagttcaaggccggcggcgcgggcgaagtgatcggctcgtgggtcggcacc
ggcgaaaaccagccgatctcggccgacacgctgcagaacgtgctcggctccgacgtcgtc
ggctcgctcgcgagcaaggtcggcatcgacccgtcgcaggcctcgtcgattctcgcgcag
gtgctgccgcacgtggtcaacggcgcgacgccgaacggcgaagtgccggccggcggccag
atcgacacgtcgaacgtgctgggcacgctcacgcagctcgccggcatgttcggcggcaac
aagcaaggctga

DBGET integrated database retrieval system