KEGG   Burkholderia vietnamiensis: Bcep1808_1780Help
Entry
Bcep1808_1780     CDS       T00493                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcep1808_1780
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcep1808_1780
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bcep1808_1780
Enzymes [BR:bvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bcep1808_1780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1937176..1938627)
Genome map
AA seq 483 aa AA seqDB search
MNYISTRGAGIGERHTFSDILLGGLAKDGGLYLPSEYPQVSADELARWRTLPYADLAFEI
LTKFCDDVPADDLRAITRRTYTAAVYSNTRHGENACDITPLKPLGTEQGTALSLLELSNG
PTLAFKDMAMQLLGNLFEYTLAKHGEALNILGATSGDTGSAAEYAMRGKAGVRVFMLSPH
RKMSAFQTAQMFSLQDPNIFNLAVEGVFDDCQDIVKAVSNDHAFKARHKIGTVNSINWAR
VVAQVVYYFKGYFAATRSNDERVSFTVPSGNFGNVCAGHIARMMGLPIAKLVVATNENDV
LDEFFRTGVYRVRSAQNTYHTSSPSMDISKASNFERFVFDLLGRDPARVMQLFRDVDEKG
GFDLAASGDFARVAQFGFVSGRSSHADRIATIRDVFARYDTMIDTHTADGVKVAREHLDA
GVPMVVLETAQPIKFGETIREALEREAERPAAFDGLEALPQRFDVVKADAQQVKDFIAAH
TGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaactacatctccacgcgcggcgccggcatcggcgagcgccacacgttttccgacatc
ctgctcggcggcctcgcgaaggacggcgggctgtacctgccgagcgagtatccgcaggtg
tcggcagacgagctcgcgcgctggcgcacgctgccgtatgcggatctcgcgttcgagatc
ctcacgaaattctgcgacgacgtgcccgccgacgacctgcgtgcgatcacgcgccgcacc
tacacggccgccgtctacagcaacacgcgccacggcgagaacgcgtgcgacatcacgccg
ctgaagccgctcggcaccgagcagggcacggcgctgtcgctgctcgagctgtcgaacggc
ccgacgctcgcattcaaggacatggcgatgcagctgctcggcaacctgttcgagtacacg
ctcgcgaagcatggcgaagcgctgaacattctcggcgcgacgtcgggcgatacgggcagc
gcggccgaatacgcgatgcgcggcaaggccggcgtgcgcgtgttcatgctgtcgccgcac
cgcaagatgagcgcgttccagaccgcgcagatgttcagcctgcaggatccgaacatcttc
aacctcgcggtcgagggcgtgttcgacgactgccaggacatcgtgaaggccgtgtcgaac
gatcacgcgtttaaggcccggcacaagatcggcacggtcaactcgatcaactgggcgcgc
gtcgtcgcgcaggtcgtctattacttcaagggctatttcgcggccacccggtccaacgac
gagcgcgtatcgttcacggtgccgtcgggcaacttcggcaacgtctgcgccggccacatc
gcgcgcatgatgggtctgccgatcgcgaagctggtcgtcgcgaccaacgagaacgacgtg
ctcgacgagttcttccgcaccggcgtctaccgcgtgcgcagcgcgcagaacacctatcac
acgagcagcccgagcatggacatctcgaaggcgtcgaacttcgagcgcttcgtgttcgac
ctgctcggtcgcgatccggcgcgcgtgatgcagctgttccgcgacgtcgacgagaagggc
ggcttcgatctcgcggcgagcggcgatttcgcgcgcgtcgcgcagttcggcttcgtgtcc
ggccgcagcagccatgcggaccgcatcgcgacgatccgcgacgtgttcgcccgttacgac
acgatgatcgacacccatacggccgacggcgtgaaggtcgcgcgcgagcacctcgacgcc
ggcgtgccgatggtcgtgctcgagacggcgcagccgatcaagttcggcgagacgatccgc
gaagcgctcgagcgcgaggccgaacggccggccgcgttcgacgggctcgaagcgctgccg
caacgcttcgacgtcgtgaaggccgacgcgcagcaggtgaaggacttcatcgccgcgcat
acgggcgcgtaa

DBGET integrated database retrieval system