KEGG   Burkholderia vietnamiensis: Bcep1808_1851Help
Entry
Bcep1808_1851     CDS       T00493                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Bcep1808_1851
Enzymes [BR:bvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bcep1808_1851
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Bcep1808_1851
Lipid biosynthesis proteins [BR:bvi01004]
 Fatty acid synthase
  Component type
   Bcep1808_1851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2015555..2016160
Genome map
AA seq 201 aa AA seqDB search
MPARAASAAPAAPEGRPTLVVLGDSLSAEYGLPRDTGWVALLRQRLATERIDYSVANASV
SGDTTSGGRARLPAVLQRLKPSIVIVELGSNDALRGVPVATTEQNLRDIIAAARRAHAQV
VLVGMYVPPNYGPDYTQKFHAVYTRLSKQLGVPLVPFLLAGIENKPEMFQSDQMHPGEQA
QRVLLDNVWPTLKPLLGKPRG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcgcgcgcggcgagcgccgcgccggccgcacctgagggccggcccacgctcgtc
gtgctcggcgacagcctgtcggccgagtacgggctgccgcgcgacaccggctgggtggcg
ttgctgcggcaacggctcgcgaccgagcgaatcgattatagcgttgcgaacgcaagcgtc
agcggcgacaccacgagcggcggacgcgcgcgattgcccgccgtgctgcaacggctcaag
ccgtcgatcgtcatcgtcgagctcggttcgaacgatgcgctgcgcggcgtgccggtcgcg
acgaccgaacagaatctgcgcgacatcatcgccgctgcgcgacgcgcgcatgcgcaggtc
gtactggtcggcatgtacgtgccgccgaattacgggcccgactacacgcagaaattccac
gcggtctatacgcgcctgtcgaagcaactcggcgtgccgctcgtgccgttcctgctggcc
ggcatcgagaacaagccggagatgttccagtcggaccagatgcatcccggcgagcaagcg
cagcgggttctgctcgacaacgtgtggccgacgctgaagccgctgctcggcaagccgcgc
ggttga

  All links  
No link information was found.   
DBGET integrated database retrieval system