KEGG   Burkholderia vietnamiensis: Bcep1808_2031Help
Entry
Bcep1808_2031     CDS       T00493                                 

Definition
peptidase C14, caspase catalytic subunit p20
Organism
bvi  Burkholderia vietnamiensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2229587..2231056
Genome map
AA seq 489 aa AA seqDB search
MPFASIHRELRDGVRATRVLTVALATGLVSLALAPASTSAATNMAADDARRVALVIANED
YAGADRLQTPVADAKLIGSELASLGYSVDLEINRTRPQMTADLARFSKAAAGARVALIYY
AGHGFEVAGQNYLIPAGVSGVRALDQDAARSLGVPLRYVLMRASEGNPQTLVALVDACRT
TPARGSDASRGFAAERAATGQFVAFSATAGGEALDSMRSLGRPVDHSPFAYFLAQRLPDA
QASVVDVMQQVQADVAKATGGAQRPWFTSGLVGWLSLATPPQKAIAGATPQWSGPMRSVS
WPTSSVGAGSGGTGSTSRPTALAGFGQRLLSMESDPPTPRRWMDEEILVDHAAITLDAAS
AAALRLWSDSGDTRATTALGLAHERGAPNAGIERDAAKAAALYGQAAKSGDGLAALWLGQ
LLARGDGVPKDLVRARALLRQAADASVMGAGSSLDALDRAGALPPRYQDVSRDANLGIAA
TLRPDQLGD
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgccctttgcatcaatccatcgggaactgcgcgacggggttcgcgccacccgcgttctg
accgttgcgctagcaaccggtctcgtgtcgctggcgctcgcgcctgcgtccacgagcgcg
gcgacaaacatggcggccgacgacgcccgccgcgtggcgttggtcatcgccaacgaagac
tatgctggggccgatcggctgcaaacgcccgtcgcggacgctaagctcattggctccgag
ctcgcgagcctgggctactccgtcgacctcgaaatcaatcgcacccggccgcaaatgacg
gccgaccttgcgcgcttctcaaaagcggcggccggcgctcgcgtcgcgctgatctactac
gcgggccacggcttcgaggttgccggccagaactatttaatcccggcgggcgtctccggc
gtccgcgcgctcgatcaagacgccgctcgatcgctcggcgtgccactgcgctacgtcttg
atgcgcgcgagcgagggcaacccgcaaacgctagtcgccttggtcgacgcctgccgcacc
acacccgcgcgtggttcggacgcctcgcgcggcttcgccgcagaacgcgcggccacaggt
caattcgtggccttctcggcgaccgccggcggcgaagcgctcgactccatgcgcagcctc
ggccgtccggtcgaccatagccccttcgcctactttctcgcccagcgcctccccgacgcg
caggcgtcggtcgtcgacgtgatgcagcaagtgcaagcggatgtggcgaaggcgacgggc
ggcgctcaacgaccgtggttcacgagcggcctggtcggatggctgagccttgcgacgccg
ccgcagaaggcgatcgccggcgcgactccgcagtggagcggccccatgcgcagcgtgtcg
tggccgacgagctcagtcggcgcaggcagcggcggcacgggctcaacctcgcgccccacg
gccttggcgggattcggccagcgcctcctgtccatggaatccgatccaccaacgccgagg
cgatggatggacgaagagattttggtggaccacgccgcgatcacgctcgacgcagcgagc
gcagcggcgctgcgcttgtggtccgactccggcgacacccgcgcgacgacggcgctgggc
ctcgcccacgagcgcggcgcgccgaacgccggcattgagagggacgctgcgaaagcggcc
gcgctatacggccaggccgccaagtcgggcgacggcctcgccgctctctggctcgggcag
ttgctcgcgcgcggcgacggcgtgcccaaagacctcgtgcgcgcaagagccctgctgcgc
caagccgcagacgcgagcgtgatgggcgcgggctcctcgctcgacgcgctcgatcgcgcc
ggcgcgcttcctccgcgctatcaggacgtctctcgcgacgccaacctcggcatcgccgcc
accttgcgccccgatcagctcggcgactag

DBGET integrated database retrieval system