KEGG   Burkholderia vietnamiensis: Bcep1808_2033Help
Entry
Bcep1808_2033     CDS       T00493                                 

Definition
Allergen V5/Tpx-1 family protein
Organism
bvi  Burkholderia vietnamiensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2232220..2233446
Genome map
AA seq 408 aa AA seqDB search
MKHATSHAQSRAICSPSRHRTRPSLRLAGCAFAAASLLAACGGGGGGSGGSTTGSGGGTS
SSSPTSAATAPIALVAAPGASTGAFTATGDVVNDTLSFINAQRAQVGLASLAFQSGVAHA
AANHALWEQDNNVIGHVETAGQAGYTAATPTDRVNLYYATTSVGEVTAGFGGSFTSSTEA
ISGLFDAPFHRAIMLFDSVYAGPGDAVASSASQLSTLTVDFADYKQVVQDNELIAWPYNG
MTNVNTSWYASESPNPMAQTTQSQAYENTIVGYPVTLSGSNNAAFSNVSFIIRNAAGATI
PCQEVDNSNNSDATREAMCVPFEPLATNTVYTVSVTGSLSNNAFAARPFSLTWSFTTAAT
ANTPVGAPTSSTTTSTSTTSTTTTNSQSEAKAARQLQQLPATRTVLFN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacgcaacttcacacgcgcaatcccgcgccatttgttcaccttcgcgccaccgc
acgcgcccttctcttcgcctagctggttgcgccttcgcggccgcctcactgcttgccgct
tgtggtggtggcggtggcggaagcggcggctccaccacgggcagcggtggcggcacgtcg
tcgagctcgcccacaagcgccgcgaccgcgcccatcgcgctcgtcgcagctccgggcgcg
agcactggcgctttcaccgccacgggcgacgtggtcaacgacacgctcagcttcatcaat
gcccagcgcgcgcaagtcgggctggcgtcgctcgccttccagtccggcgtcgcgcacgct
gcggcgaaccacgcgctctgggagcaagacaacaacgtcatcggccacgtcgagaccgca
ggccaggccggctacacagcggcgacgccgactgatcgcgtgaatctctactatgcgacc
acgtccgtgggcgaagtcacggcagggttcggtggctcattcacgagctcaaccgaagcg
atcagcgggcttttcgacgcgccttttcaccgcgccatcatgcttttcgactccgtctat
gccggccccggcgacgcggtggcgtcgagcgcgtcgcaactctcaacgctcacggttgac
ttcgccgactacaagcaggtcgtgcaagacaatgagctgatcgcctggccctacaacggg
atgacgaacgtcaacacgtcgtggtatgccagcgagagccctaacccgatggcacaaact
acgcagtcccaggcttacgagaacaccatcgttggttatcccgtgaccctcagtggaagc
aacaatgcggcgttctccaatgtgagcttcatcattcggaacgcggccggcgcaacgatc
ccatgccaggaggtcgacaactccaataattcggacgcgacgcgcgaagcgatgtgcgtg
cccttcgagccgctcgccaccaacacggtctacaccgtcagcgtcacgggctcgctctca
aacaatgccttcgccgcgcgcccgttctcgctgacgtggtccttcacgaccgccgcgacc
gcaaacaccccggtcggcgcgccaacgagcagcaccacgacgagcacgagcacgaccagc
accacgacgacaaactcgcagagcgaggcgaaggcggctcggcaattgcagcagctcccg
gcgacgcgcacggtgctcttcaattga

DBGET integrated database retrieval system