KEGG   Burkholderia vietnamiensis: Bcep1808_2040Help
Entry
Bcep1808_2040     CDS       T00493                                 

Definition
hemolysin activation/secretion protein-like protein
Organism
bvi  Burkholderia vietnamiensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2244188..2246005)
Genome map
AA seq 605 aa AA seqDB search
MTDPRLGRATAHAPSTFARLRARPIARAIAWALIASMTGLPCIPALAAVVATASGSGSDS
EPGNPAQGAASQNGATATQGGLAAPDASESATLGGAVTPDGFGVAPVDLLGWRVESNDAK
LLDAATGDWHEQDAKPLGVDVNGRADAKALAVALQARALSAGFASVYTQVDPNRGVIRLN
LLPVHITQSGRNDYLRFFTPIDGKPASASKLAAATRLTQESAAINGDHVAITLSNPTNPM
SLDAAVASGNARAAAAGTDTGDAMPLSIESQPADDQKTYGGALAFSTYGQRYSGRDTLTE
SGYARITDGVQANVSASQGLPGLPPHGDDSNGGRFYSESAGVRGVTPWGIGSLLYSHTDY
RQGGPDFRDFDINGTIDRLDAQFERPLSQGLSVFFGLSAATQRQSIGVAGLDDRQNLLFA
QAGINYQGAIGILSGRVMQGLAGSDKYNLAPLSGPFDSHFTAVAIDARKSIALAPRWTLD
LSASAQAGSSGTPSVNAFYLGGLDRGRGYTTGNLAGSDGVAASATIGYAVHPLWTLYAGI
DGGIVKPAEIGAQTESSVFVGVKTSHPIRMGHVFASMDFGFAKPLNGPAGERKSPTFGAF
LTLGF
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccctcgccttgggcgcgcgaccgcgcatgccccgtcgaccttcgcgcgcctg
cgcgcacgccccattgcccgcgcgattgcttgggcgctcattgcttcgatgaccgggctg
ccgtgcattcccgcgcttgccgccgtggtcgcaaccgcctcaggctcgggctccgattcg
gagcccggcaatccggcgcagggtgccgcgtcgcagaacggcgcgaccgccacgcaaggc
gggttggcggcgcccgatgcgagtgagtcggcgaccctcggcggcgcggtcactcctgat
ggctttggtgtcgcgcccgtggatctgctcgggtggcgcgtcgagtccaatgacgcgaag
ctcctcgatgcggcaaccggcgactggcacgagcaagacgcgaagccgctgggcgtcgac
gtcaacggccgcgcggacgccaaagctctcgccgtcgcgttgcaagcgagggcgttgagc
gcgggctttgcatccgtttacacgcaggtggatccgaatcgcggcgtgattcgactgaac
cttctgccggtccacatcacgcagagcgggcgcaacgattaccttcgcttcttcacgccg
attgatggcaagcccgcaagcgcatcgaagctcgcagcggcgacgcgcctgacgcaagag
tcggccgcaataaacggcgatcatgtcgccatcacgctgtcgaatccgaccaatccgatg
tcgctggacgcggcagtggcctcgggcaacgcccgcgccgcggcggccggcacggacact
ggcgacgcgatgccgctctcgatcgagagccagcctgctgatgatcaaaagacctacggc
ggtgccctcgcgttctcgacttatggccaacgctattcagggcgcgacacattgacggag
tcgggctacgcgcggatcaccgacggcgtgcaagcgaacgtctccgcttcgcaaggactc
ccaggcttgccgccgcacggcgacgattcgaacggcgggcgtttctactccgagtcggcg
ggtgtgcgtggcgtcacgccatggggtatcggatcgctcctctattcgcacacggactac
cggcagggcggtcccgatttccgcgattttgacatcaacggcacgatcgaccgcctcgac
gcccaattcgaacgacctctgagtcaaggcctctccgtcttcttcggcctctctgcggcc
acgcaacgtcaaagcattggcgtggccggcctcgacgatcgtcagaacctgctcttcgcg
caagctgggatcaactaccaaggtgcgatcggcattctctccgggcgcgtgatgcaaggg
ctcgccggctccgacaaatacaacctcgcgccgttgtccggcccgttcgactcgcacttc
acagccgtggccattgacgcgaggaagtcaatcgcgctcgcgccgcgctggacgctcgat
ctatccgcaagcgcacaagcgggatcgagcggcacgccctcggtcaacgcgttctatctc
ggcggcctcgaccgcgggagaggctacacgaccggcaatctggcgggctcagacggcgtc
gcggcaagcgcgacgatcggctatgccgttcatccgctctggacgctatacgccggcatc
gatggcggcatcgtcaaacctgccgagatcggagcacagacggagtcgagcgtcttcgtc
ggcgtcaagacctcgcatccgattcgaatgggccacgtcttcgcgagcatggattttggc
ttcgcaaagccgctcaacggacccgcaggcgaacgcaagagcccgacgttcggtgcgttt
ttgacgctgggattttga

  All links  
No link information was found.   
DBGET integrated database retrieval system