KEGG   Burkholderia vietnamiensis: Bcep1808_2081Help
Entry
Bcep1808_2081     CDS       T00493                                 

Definition
AAA ATPase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bvi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2302587..2305163)
Genome map
AA seq 858 aa AA seqDB search
MPPPERANAPGYGSGNAHSQEPSKAFDPHPGFVGANLTAAQAKKLLSGGCFPSCTPTLAS
SLVEWFGGRVFDRIFLNDPKAYEICGPRWEDLNRAVVEKHELLPLMNWMSELGANATTIG
RAIEWAVDAENENAGEGPAVYFDAVLKDPHLLTEAPGIGFFKADDLALRAGVATASEQRQ
LACARAALTEACDNAGGGARLGDVEQKVCHFLGANGAMGAPEARGRAPTALHMARQKGLL
KDATDEQGRPMVFSADFFDAEEQCAHILLRMAKDQSPYHALDRKQALADAQEITGLKLLE
QQQQAVEVLFEGRVAIISGKPGAGKTTLLKCVAPILEKDGRAVHYAAPTGKAAKRMRQSI
ERPTSTIHRMLGLGRGGAKARPDDENPLKTASAVVIDEASMLDAKLTLAILRSIGPKTLL
VLVGDPGQLPSIRAGKVLADLMDSNAFPTARLTNVVRQGAQSDIVKVARAIDSGESPDFT
LHPDSPPERKKSDCVFLEEPNAQRLGDRIANMLRNAQVDAKMDPLRDAQVIAASNVGPTG
AVALNATLQAAFNPPEPNKPELHVKRTVKGVDQSFALRFGDKVMQTSNEASKALFDGPSD
RSKPLEEKGIFNGDVGYIVAMDRVSMWVQFDNGHAHFSNDEARKSLTLSYANTVHKFQGS
ESPLIFFAMHESTPKPLLTRNLAYTAITRARTKCIVIGSERRLNEAAGRDALATRHTRLK
GLLSGAIAPVSAPKDVVAIFASKAVERALAPNAPGADAVRSTAPVAQSSAAPASASQVSH
VVATEAIGQAANPVASQSRAGQATNAIASPDATQSERASAPSQPRASAADPVDDDAAFAA
FAAYAGMGAGRGVRGMRA
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
gtgccgccgcccgagcgcgcgaatgcaccgggctatggctcgggaaatgcccactcccag
gagcccagcaaagcgttcgatccgcatccggggttcgtcggcgctaacctcacggccgcg
caagcgaagaagctcctctccggcggctgcttcccgagctgcacgccgacgctggcgtcg
agcctggtcgagtggtttggcggacgcgtgttcgaccgcatttttctgaacgatccgaag
gcatacgagatttgcggcccacgctgggaggatctaaatcgcgcggtggtcgagaagcac
gagctcctgcccttgatgaactggatgagcgagctcggcgcgaacgcgacgacgatcggc
cgcgcgatcgagtgggccgtcgatgcggagaacgagaacgcaggggaggggccagccgtt
tacttcgacgcggtgctcaaagacccgcacctgctcacggaagcgcccggcattggcttc
ttcaaggccgacgacctcgcgctgcgcgcaggtgtggcaaccgcgagcgagcagcggcag
ctcgcctgcgctcgcgcggcgctgaccgaagcatgcgacaacgccggtggcggcgcgcgt
ctcggcgatgtcgagcagaaggtctgccattttcttggcgcgaacggcgccatgggcgcg
cccgaggcgcgtgggcgcgcgccgaccgcgctgcacatggcccggcaaaaggggctgcta
aaagacgcgacagacgagcaaggcaggcccatggtcttctccgcggatttcttcgacgcc
gaggagcagtgcgcccacatccttctgcgaatggccaaggatcagagcccctaccatgct
ctcgatcgcaaacaagcgcttgcggatgcacaagagatcacgggactcaaactcctcgag
cagcagcaacaggcagtcgaggtgctcttcgagggacgcgtcgcgatcatctcgggcaag
cctggcgcaggcaagacgacgctgctcaaatgcgttgctccgatcttggagaaggacggg
cgcgcggtgcactacgcggcgcccacaggtaaagccgcgaagcgcatgcgtcaatcgatc
gagcggccgacgagcacgatccaccgcatgctcgggctcggccgcggcggcgccaaggct
cgccccgacgacgagaatccgttgaagaccgcgagcgcggttgtgatcgacgaggcatcg
atgcttgacgcgaagctcacgctcgcgatcttgcgttcgattgggccgaagacgctgctc
gtgctcgttggcgacccaggccagctgccgagcattcgcgcgggcaaggtgcttgcggat
ttgatggactcgaatgcattccccacagcgcggctcacgaacgtcgttcgacaaggcgcc
caaagcgacatcgtgaaggtcgcgcgtgcgatcgactcgggtgaatcgcctgatttcacg
ctgcaccccgattccccgcccgagcgcaaaaagtcagattgcgtcttcctcgaagagccc
aacgcgcaacggcttggcgatcgcatcgcgaacatgctgcgcaatgcgcaggtcgacgcg
aagatggacccgcttcgcgacgcacaggtgatcgccgcgtcaaacgttggccccaccggc
gcggtcgcgctcaacgcgaccttgcaggccgcgttcaacccgccggagccaaacaagccc
gagcttcacgtgaagcgcacagtcaagggcgtcgatcagagtttcgcgttgcggttcggc
gacaaggtcatgcagacctcgaacgaagcgagcaaggcactgtttgacgggccgtcggat
cgatccaagccgcttgaagagaagggcattttcaacggcgacgtcggctatatcgtcgcg
atggaccgtgtgtcgatgtgggttcagttcgacaacggccacgcccatttttcgaacgac
gaggcgcgcaaaagcctcacgctctcctacgccaatactgtccacaaattccagggctcc
gagtcgcccttgatcttcttcgccatgcacgagtcgacgcccaagccgctgctcacgcgc
aacctggcctacacggcgatcacgcgcgcacgcacgaaatgcatcgtcatcggcagcgaa
cggcgcctcaacgaggccgctgggcgggacgcgctcgcgacgcgccacacgcggttgaag
gggctcctgagcggcgcaatcgcacccgtctcggcccccaaggatgtcgtggcgatcttc
gcgagcaaggcagtggagcgtgccctcgcgccgaacgcgcccggtgccgacgcagtgcga
tccacggcgccagttgctcaatcttctgcggccccggcatcggcgagccaggtctcacac
gtcgtcgcaaccgaggccatcggccaggccgcgaacccggtcgcgagccagagccgcgcg
ggccaggccacgaacgccatcgcgagcccggatgcgacgcagagcgaacgcgcctcagcg
ccgagccagcctcgcgctagcgccgccgacccggtcgacgacgacgcagccttcgcggcg
tttgcagcttacgctgggatgggagcagggcgcggcgtgcgtggaatgcgcgcgtga

DBGET integrated database retrieval system