KEGG   Burkholderia vietnamiensis G4: Bcep1808_2148Help
Entry
Bcep1808_2148     CDS       T00493                                 

Definition
(GenBank) hypothetical protein
Organism
bvi  Burkholderia vietnamiensis G4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: H-K_ATPase_N
Motif
Other DBs
NCBI-ProteinID: ABO55150
JGI: Bcen18082148
UniProt: A4JFU7
Position
1:complement(2380310..2381584)
Genome map
AA seq 424 aa AA seqDB search
MRPLFVPLKRLRPQPLRRSRTDLVLAALALCGTLAGCDKHPVAVHTPASLTPSSVALRSI
GSASGHGRQDTRDGRDPATTAAMAALTASSTTPATPVSAAAIASTTSPAPTGRDLSATAD
TSALASLAVELAHGPTGASLDARLQEDKAREGGKRKRTTSVAAATPAQVVHDLVVDPVSR
NAPFGGEIAILSQLTAAQAAGGGAIASAASRKGARLGGPLSEGSLVFDLHSGRLARASGV
EEWRAFAAQGLKGSRAKLDATRWPLGVRNRNPGNLRDNATGGFRLFDTFEDGIHSADANL
LDYGVHHHINTLTGVINRWAPAGDGDNNPAIYAAAVSKATGIGVDDVIDLRDPAVRQHIL
AAMFDVESPGWRVAMQQSPTAFAALTGNLPRRQALKPAPNFEPAPSLRPETPETREPALS
GEDV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccactctttgtccccttgaagcggctgcgtcctcagccgcttcgtcgttcccgc
acagatctcgtgcttgccgcgctcgccctttgcggcacgttggccgggtgcgacaaacac
cctgtcgcggtccacacgccggcttcgctgacgccgtcctcggtcgcgctgcgctcgatc
gggagcgcgagcgggcacggtcgccaggacacccgtgacggccgcgacccggcgaccacc
gcagcgatggctgccttgacggcgagctcgaccactccggcgacgccagtttcggcggct
gcgattgcttcgacgacttcccccgcgcctacgggccgagacctctcggccacggcggac
acgagcgcgctcgcgtcgctggccgtcgagctcgctcacggacccacgggcgcgagtctc
gatgctcgcttgcaagaggacaaggcgagggagggcggcaagcggaagcgcacaacgtcc
gtggccgccgcaacgccggctcaagtcgtgcacgatctcgtcgtcgacccggtcagtcgt
aacgcgccctttggtggcgagatcgcgattctgagccaactgactgcggcgcaggcggct
ggcggcggcgccatcgcctctgccgcttcgcgcaagggcgctcgactgggtggcccgctg
agcgaaggctcgctggtcttcgatcttcactcggggcgcctcgcgcgcgcctccggcgtc
gaagaatggcgcgcattcgcggcccaaggcctcaaaggctcgcgcgccaaactcgacgcg
acgcgttggcccttgggcgtgcgcaaccggaatccgggaaacctgcgcgacaacgctacg
ggcggcttccgcctcttcgacacgttcgaagacgggatccactcggccgacgcgaatctg
ctcgactacggagtgcatcaccacatcaacaccctgacgggcgtcatcaaccgttgggcg
cccgccggcgatggcgacaacaaccccgcgatttacgctgcggcggtctcgaaggcaaca
ggcatcggcgtcgacgacgtcattgacctgcgtgatccagccgtccgccaacacatcctc
gcggcgatgttcgacgtcgagtccccgggttggcgcgtcgcgatgcagcagtcgccgaca
gcgttcgcggcattgacgggcaatctgccgcgtcgccaagccctcaaacccgcgcccaat
ttcgagccggcgccgagcctgaggcctgagacgcccgagacgagagagccagcgctctcg
ggcgaagacgtctaa

DBGET integrated database retrieval system