KEGG   Burkholderia vietnamiensis: Bcep1808_2182Help
Entry
Bcep1808_2182     CDS       T00493                                 

Definition
hexapaptide repeat-containing transferase
Organism
bvi  Burkholderia vietnamiensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2419446..2419970
Genome map
AA seq 174 aa AA seqDB search
MTIYKLGDTAPTIHESVFVADTAAIIGKVVLEQNASVWFGATIRGDNETITVGAGSNVQE
GAVLHTDPGFPLTIAENVTIGHQAMLHGCTVGEGSLIGIQAVVLNGAVIGRNCLVGAGAV
VTEGKTFPDNSLILGAPAKVVRELSADDIARLRANAKTYVERRAHFKEQLVRIG
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatctacaaactgggcgatacggccccgacgatccacgaaagcgtgttcgtcgcc
gatacggcggccatcatcggcaaggtcgtgctcgagcagaacgcgagcgtgtggttcggc
gcgacgattcgcggcgacaacgagacgatcaccgtcggcgccggcagcaatgtccaggaa
ggtgcggtcctgcatacggaccccggtttcccgctgacgatcgccgagaacgtgacgatc
ggacatcaggcgatgctgcacggctgcacggtcggcgaaggttcgctgatcgggattcag
gcggtggtcttgaatggtgcggtgatcggccgcaactgtctggtcggtgccggcgcggtc
gtgacggaaggcaagacgttcccggacaactcgctgattctcggcgcaccggcgaaagtc
gtgcgcgagctgtcggcagacgacatcgcgcggttgcgcgccaatgcgaagacgtacgtc
gagcgccgtgcgcatttcaaggagcaactcgtgcggatcggctga

DBGET integrated database retrieval system