KEGG   Burkholderia vietnamiensis: Bcep1808_2297Help
Entry
Bcep1808_2297     CDS       T00493                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcep1808_2297
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Bcep1808_2297
Enzymes [BR:bvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Bcep1808_2297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2551957..2552745)
Genome map
AA seq 262 aa AA seqDB search
MAADLNGKTAVVTGAASGIGKEIALELAKAGAAVAIADLNQDGANAVADEINKAGGKAIG
VAMDVTSEDAVNSGIDKVAETFGSVDILVSNAGIQIVNPIENYSFADWKKMQAIHVDGAF
LTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNV
RSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGNTVDGVFTTVQDVAQTVLFL
SAFPSAALTGQSFVVSHGWFMQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagacctgaatggcaagaccgcagtcgtcacgggcgccgcgagcggcatcggc
aaggaaatcgcgctggagctggcgaaggccggcgcggccgtcgcgatcgccgacctgaac
caggacggcgcgaacgcggtggccgacgagatcaacaaggccggcggcaaggcgatcggc
gtcgcgatggacgtcaccagcgaggacgcggtgaacagcggcatcgacaaggtcgccgag
acgttcggctcggtcgacatcctggtgtcgaacgcgggcatccagatcgtcaacccgatc
gagaactactcgttcgccgactggaagaagatgcaggcgattcacgtcgacggcgcgttc
ctcacgaccaaggctgcgctcaagcacatgtacaaggacgaccgcggcggcgtcgtgatc
tacatgggctcggtgcactcgcacgaggcgtcgccgctgaagtcggcgtacgtgacggcc
aagcatgggctgctggggctcgcgcgcgtgctggcgaaggagggcgcgaagcacaacgtg
cgctcgcatgtggtgtgtccgggcttcgtgcgcacgccgctggtcgacaagcagattccg
gagcaggcgaaggagctcggcatcagcgaggaagaagtggtgaagaaggtgatgctcggc
aacacggtggacggcgtgttcacgacggtgcaggacgtcgcgcagacggtgctgttcctg
tcggcattcccgagcgccgcgctcaccggccagtcgttcgtcgtcagtcacggctggttc
atgcagtga

DBGET integrated database retrieval system