KEGG   Burkholderia vietnamiensis: Bcep1808_2336Help
Entry
Bcep1808_2336     CDS       T00493                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcep1808_2336 (tpiA)
   01230 Biosynthesis of amino acids
    Bcep1808_2336 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep1808_2336 (tpiA)
   00051 Fructose and mannose metabolism
    Bcep1808_2336 (tpiA)
   00562 Inositol phosphate metabolism
    Bcep1808_2336 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bcep1808_2336 (tpiA)
Enzymes [BR:bvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bcep1808_2336 (tpiA)
Exosome [BR:bvi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bcep1808_2336 (tpiA)
  Exosomal proteins of bladder cancer cells
   Bcep1808_2336 (tpiA)
  Exosomal proteins of melanoma cells
   Bcep1808_2336 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2593184..2593939)
Genome map
AA seq 251 aa AA seqDB search
MSKQRTKRVIGNWKMHGRLAGNQALLNEVVQGADAVVAGTSIGVCVPFPYLAQVQAVLGG
SRVAFGAQDVSAHEQGAYTGEVAAAMVAEFGAQYAIVGHSERRAYHGERNETVAAKAQRA
LAAGLTPVVCVGETLDEREAGTTEQVVGAQLDAVLAVLTADEAARIVVAYEPVWAIGTGK
SATSAQAQDVHAVLRARLAAKGAAHVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKA
EDFLAICRAAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaacgaacaaagcgagtgatcggcaactggaagatgcacggccggctggcc
ggcaaccaggcgctgctgaacgaagtggtgcagggcgcggacgcagtggtggccggcacg
tcgatcggcgtatgcgtgccgttcccctatctcgcgcaggttcaggcggtgctcggcggc
agccgggtggcgttcggcgcacaggacgtgtcggcgcacgagcagggcgcgtacaccggc
gaagtggcggccgcgatggtcgcggaattcggcgcgcagtatgcgatcgtcggtcactcg
gagcgtcgcgcgtatcacggcgagcgcaacgagaccgtcgccgcgaaggcgcagcgcgcg
ctcgcggcgggcctcacgccggtcgtgtgcgtcggcgaaacgctcgacgagcgcgaagcg
ggcacgacggagcaggtcgtcggtgcgcagctcgacgccgtgctggccgtgctgacggcc
gacgaggcggcgcgcatcgtcgtcgcgtacgagccggtctgggcgatcggcaccggcaag
agcgcgacgtcggcgcaggcgcaggacgttcacgcggtcctgcgtgcgcgtctcgcggcg
aagggtgcggcgcacgtgtcggtgctgtacggtggcagcgtcaagccggacaacgcggaa
gaactgttcgcgcagccggacatcgacggcggcctgatcggcggcgcgtcgctgaaggct
gaagattttctggcgatctgccgggctgcgcgttga

DBGET integrated database retrieval system