KEGG   Burkholderia vietnamiensis: Bcep1808_2466Help
Entry
Bcep1808_2466     CDS       T00493                                 

Definition
hypothetical protein
Organism
bvi  Burkholderia vietnamiensis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2733054..2735612
Genome map
AA seq 852 aa AA seqDB search
MKMNKGDTIAPHDRTFRAIGVVLAALAFAAPPVFAQFTPGQVLKAVDLNNAISKPAIIGG
SIDGAPVGAATPSSGKFTSLSATGTATLNSLASSGATITGGSINGAPIGQSTPAAGAFTS
FSAGASVFTGQVSLGGSAGAEALRAVTTSSAVNWVQVNGQVTGIAPGISSQGSDANINLA
YSTKGSGNHLFSTGSFARTQFVIADVPSAVNYVQVQGAATSGGPAVSAQGSDTNINLTLA
AKAAGAVVFTTNAITQAAVVNTASANRYLTFTGSNGGNPTIGASAGRVAITPGLDASPIG
AVTPSTGAFTTLSASGVASVAYNSPVFALNDVGGAGKGYIQFQKAGAAAWNIGNASNASN
QFGLDRYVSGSYVDTPITISNTTGIVSMSDGLSVTGTVSGSGFDNYITSANTIGLIDSMT
NAKAYGALGNSNGTHGNGNDDTTALQNALNASANGILHIPCGTYRITASLQESSTNNYWI
KGDGQCTKIYNDASTAVPTFLFNPSTANGNVNPTVRIEGIYFYNPYVTGAGQTAASFVNE
ERPYFLNNIIYGYQVGVNFTSTYAPVIDHNTFFRTVGSAIDCSIDTSCNSATITQNGFFT
NGLVNSAPAINLNTPSSINAISITGNDMEANYSGILFSNVFGAIVSGNYIENQTACNLCF
NSGNSSIDFNGNWFGASPSLTLTNGLSNSKFQNNATYNYAITQGTSTSVRQINNTAVGTG
GISLPTVGQLNSNTTTGTSMTSNTPINCTSITLPAGTWDVSGSVQFSPATSTVVNYMHSS
ISLTSATVAPLPNRADIGGISATGNTVGSMALSTPVVRETFATSTPVYLVGNSTFTTSSM
ACNGYIRAVLVQ
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaacaaaggcgacactattgcgcctcatgaccgaacgttccgggcgatcggc
gtcgtgttggctgccctcgcgttcgccgccccccctgtatttgcacaattcacccccggc
caggttctcaaagccgtcgacctcaacaacgcaatttcgaagccggcaatcatcggtggc
tcgatcgacggtgcgccagtcggcgcggcaacgccgagctccggaaaattcacgtctctt
tctgcgacgggtacagcgacgctgaactcgctcgccagttctggcgccactatcaccggt
ggctccatcaacggggcgccgatcggccaaagcacgccggcagctggtgcattcacatcg
ttttcggctggcgccagcgtcttcaccggccaggtaagccttggcggctcagctggcgcg
gaagctctgcgcgcggtcacgacttcgagcgcggtgaactgggtacaggtgaacggccag
gtaacgggtattgcgcccgggatttcgtcgcaaggtagcgacgctaatatcaatctcgcg
tattccaccaagggcagcggcaatcacctgttttccacgggaagcttcgcgcgcactcag
ttcgtcattgctgatgtgcctagcgccgtgaactatgtgcaggtgcagggtgcagccacc
tctggcggcccggcagtatcggctcaaggttcggataccaacatcaatttgacgcttgct
gcaaaggcagccggcgctgtcgtattcacgacgaatgcaatcactcaagccgcagttgtc
aatacggccagtgccaaccggtacctcaccttcacaggttcgaatggcggcaacccgacg
atcggcgcaagcgctggtcgtgttgcgatcactcctggcctcgacgcctctccgattggt
gcagtcacgccgagcacgggcgcgttcactacgctttcagcgagcggtgtggcatcggtc
gcttacaacagccctgtttttgcactgaacgacgtgggaggggcaggcaaggggtatatc
cagttccagaaagcaggcgcagccgcatggaatattgggaacgcgtccaatgcgtcgaac
caatttgggttagatcgttacgtttctggctcgtatgtcgacacgccgattactatctcg
aatacgactggcattgtgtccatgtcggatggcctttcagtcaccggcactgtcagcggc
tccggcttcgacaactacattacgagcgcgaacacgatcggcttgatcgattcgatgacc
aacgcgaaagcgtatggtgcactcgggaattcgaacggcacgcatggcaacggcaatgac
gacacgaccgcgttgcagaatgcgctgaatgcgtcggccaacgggatcctgcatatcccg
tgcggcacatatcgcatcacagcatcgctgcaagagtcgtcgacgaacaactactggatc
aagggcgatgggcagtgcacgaagatctataacgatgcgtcgacggcggtaccgacgttc
ttgttcaacccgagcacggcgaacggcaacgtcaacccgacggtcaggatcgaaggaatc
tatttctacaatccgtacgttacgggtgcgggccagacggcggcctcgttcgtcaatgaa
gagcgtccgtattttctgaacaacatcatttacgggtatcaggtgggggtgaacttcacg
tccacttacgctcctgtcatcgatcacaacacgttcttccgtaccgtcggatccgcgatc
gattgctcgatcgacacgagttgcaacagtgcgaccatcacccaaaacggattctttacg
aatggcctcgtcaactcggctccggccatcaacctaaacacgccttcgagcatcaatgcc
atctccatcacgggaaatgatatggaggcgaactactccggcattctgttttcgaacgtg
ttcggtgcaatcgtctcggggaactacatcgagaaccaaaccgcctgcaacctgtgtttc
aactccggaaactcttcgatcgacttcaatggcaactggttcggtgcatcaccgtcgctg
acgcttactaatgggttgtcgaacagcaaattccaaaacaatgccacctacaactacgcg
atcacgcagggaacgtcgacgagcgttcggcagatcaataacactgcggtgggcacaggt
ggaatttcgctacctacggttggccagctgaatagcaatacgacgacgggcacgtcgatg
accagcaacacaccgatcaactgcacgtcgatcaccttgccggccggcacgtgggacgtg
agcggcagcgtgcagttttcgccagcaacttcgacggtcgtcaactatatgcattcgagc
attagcctgacgtcggcgaccgtggcacctctgccgaatcgagccgatattggcgggatc
agtgcgacagggaacaccgttggatcgatggcactgtcaacgccagtcgtgcgcgaaacc
ttcgcgacgtcgactcccgtgtacctggtcggaaactcgacattcacgacgagctcaatg
gcgtgtaatggctacattcgcgccgtgctggttcagtga

DBGET integrated database retrieval system