KEGG   Burkholderia vietnamiensis: Bcep1808_2508Help
Entry
Bcep1808_2508     CDS       T00493                                 

Definition
bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase (EC:4.2.1.75 2.1.1.107)
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bcep1808_2508
Enzymes [BR:bvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Bcep1808_2508
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Bcep1808_2508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2776481..2778463)
Genome map
AA seq 660 aa AA seqDB search
MAGGARAFTAVLTRPDGQSAALAAQLADAGCDVLEFPLIDIAPLDDPAPLVAAFATLADY
ALVIFVSPNAIDRALAHYGAIWPNALPVGVVGPGSVAALARHGIAAPAHRVIAPQAGADG
GVPRYDSESLFACIEAAFGGAQALAGKRVLIVRGDGGREWLAERLREAGAEVTLVAAYRR
VVPEPRVGAWERVHALLAGAPHAWLVTSSEGVRNLHELARTHLNDAEIDALKHARLLAPH
PRIEQTARALGFDRITLTGAGDERIVRAFRTMADEAVQPATAAPVTKRMTDTNDSKSVAS
QPAAASAPPRSPSYVASEPPARRGGSAALWFVIVVLGCAAGVGGYALNRKVDRLDASFVA
RQKSLDAQTAELRTKTEQALTGTHQVDTQLAQLDGKLADAQSAQQALQQQYQDLSRNRDA
WMLEEVDQMLSSASQQLQLTGNTQLALIALQNADARLATSQSAQAVTVRKALAQDIEKLK
AAPSADLTGLAIKLDDAIAKIDALPLSGEAIVAHAAPKAAPSAAASSAAPAAAAGEPRWK
VWWHDFSAGLGQQLKGLVQVRRIDNADAMLASPDQGYFVRENVKLRLLTARLSLLARNDA
AMKSDLHAAQASLGKYFDQASKDTQSVEDLLKQVDGASLTVAVPNLNTSLNAVQQFKSRG
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcggcgcgcgcgcgttcaccgctgtcctgacccgcccggacggccagtcggcc
gcccttgcggcgcagctcgccgacgccggctgcgacgtgctcgaatttccgctgattgac
atcgcgccgctcgacgatccggcgccgctcgtggccgcgttcgcgacgctggccgactac
gcgctcgtgatcttcgtgtcgccgaacgcgatcgaccgtgcgctcgcgcactacggcgcg
atctggccgaatgcgctgccggtcggcgtcgtcggccccggcagcgtcgcggcgctcgcg
cgtcacgggatcgcggcgcccgcgcatcgcgtgatcgcgccgcaggcgggcgccgacggc
ggcgtgccgcgctacgattcggaaagcctgttcgcctgcatcgaggccgccttcggcggc
gcgcaggcgctcgcgggcaagcgcgtgctgatcgtgcgcggcgacggcggccgcgaatgg
ctcgccgagcgcctgcgcgaagccggcgccgaggtcacgctggtcgcggcataccggcgc
gtcgtgcccgagccgcgggtcggcgcgtgggagcgcgtgcatgcgctgctggccggcgca
ccgcacgcgtggctcgtcacgagttccgaaggcgtgcgcaacctgcacgaactcgcgcgg
acccatttgaacgacgccgagatcgacgccttgaagcatgcgcggctcctcgcgccgcac
ccgcggatcgagcagaccgcgcgcgcactcggttttgataggattacgctgaccggcgcg
ggcgatgagcgcatcgtccgcgcgtttcgaacgatggccgacgaggccgtccaaccggcg
acagccgcaccggtgactaaacgcatgacagataccaacgattccaaaagcgtcgcttcc
cagccggccgctgcctccgcgccgccgcgcagtccctcttacgttgcgtccgaaccgccg
gcgcgccgcggcggcagcgcggcgctgtggttcgtcatcgtcgtgctcggctgcgcggcg
ggcgtcggcggctatgcgctgaaccgcaaggtcgaccggctcgacgcttcgttcgtcgca
cgccagaagtcgctcgacgcgcagacggccgagctgcggacgaagaccgaacaggcgctc
acgggcacgcaccaggtcgacacgcagctcgcgcagctcgacggcaagctcgccgacgcg
cagagcgcccagcaggcgctgcagcagcaataccaggacctgtcgcgcaaccgcgacgca
tggatgctcgaggaagtcgaccagatgctgtcgagcgcgagccagcagctgcagctgacc
ggcaacacgcagctcgcgctgatcgcgctgcagaatgccgacgcgcgcctcgcgacgtcg
cagagcgcccaggccgtcaccgtgcgcaaggcgctcgcgcaggacatcgagaagctgaag
gccgcgccgtcggccgacctcacgggcctcgcgatcaagctcgacgacgcgatcgcgaaa
atcgacgcgctgccgctgtcgggcgaggcgatcgtcgcgcacgcggcgccgaaggccgca
ccgtccgccgccgcgtcgtccgctgcgcccgccgccgcggccggcgagccgcgctggaag
gtgtggtggcacgatttctcggcgggcctcggccagcagttgaagggcctcgtgcaggtg
cgccgcatcgacaacgcggacgcgatgctcgcgtcgcccgaccagggctacttcgtgcgc
gagaacgtgaagctgcgcctgctcaccgcgcggctgtcgctgctcgcgcgcaacgacgcg
gcgatgaagtccgacctgcatgctgcgcaggcgtcgctcggcaagtatttcgatcaggcc
tcgaaggacacgcaatcggtcgaagatctgctcaagcaggtcgacggcgcatcgctgacg
gtcgcggtgccgaacctgaacacgagcctgaacgccgttcagcagttcaagagccggggg
taa

DBGET integrated database retrieval system