KEGG   Burkholderia vietnamiensis: Bcep1808_2801Help
Entry
Bcep1808_2801     CDS       T00493                                 

Definition
hypothetical protein
Organism
bvi  Burkholderia vietnamiensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3102091..3103719)
Genome map
AA seq 542 aa AA seqDB search
MQDSNELLIPLLPPLLALLGHAADARARGDADVHALWLAAAGQLHAADSAALAQLTTTLV
ARQRIADALALAECAARVHPGVAALFNHGYALQMAGRHADAVAPYRAAYALDPRWPSLRN
NLAIALRLSGGDRDEEIALLDAAVEADPYDVQAWINLVVARLAALDLDGALASAARLAEI
APDNALALNNIAMAMKEAQRWDDAERYATRACELAPDDASFRFNLAIIQLVRGNYAAGWR
GHEARWDGAGELRGRRPALPGPRWQGEPLAGKTLLVWGEQGLGDVLQFARFVAPLAERAH
REGGRLVWNTFPQLGALMQRSLGAHVDAFSAGGGVDTLPPFDYEVPLIGLPLMLGMETST
LGASVPYLHAEPHARDAWRARLAGERRLKVGLVWTGSAGHQRNPFRRVGLARYADAFGGI
DGVAFYSLQPGADADVAAARAAGFAIEDFTAELKSFDDTAAFIGALDLVITVCTSVAHLS
GALGARTWVALDVNPHWPWLLDRTDSPWYPSATLYRQPTFGAWAPVMDALARDLRGLAAG
RG
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcaagactcgaacgaactcctgattccgctgctgccgccgctgctcgcgctgctcggc
cacgccgccgacgcgcgtgcgcgcggcgatgccgatgtgcacgcactgtggctggccgcg
gccggccagctgcacgccgccgatagcgcggcgctcgcgcagctgaccacgacgctcgtc
gcgcggcagcgcatcgccgacgcgctcgcgctggcagaatgcgcggcgcgcgtgcatccc
ggtgtcgcggcgctgttcaaccacggctacgcgctgcagatggccggccgtcacgcggac
gcggtcgcgccgtaccgcgcggcctatgcgctcgatccgcgctggccgtcgctgcgcaac
aacctcgcgatcgcgctgcggctgtcgggcggcgatcgcgacgaggaaatcgcgctgctc
gacgcggccgtcgaggccgatccgtacgacgtgcaggcgtggatcaacctggtcgtcgcg
cggctcgcggcgctcgacctcgacggcgcgctcgcatccgcggcgcggctcgcggagatc
gcgcccgacaacgcgctcgcgctgaacaacatcgcgatggcgatgaaggaggcgcagcgc
tgggacgacgccgagcgctacgcgacgcgtgcgtgcgaactcgcgcccgacgacgcatcg
ttccgtttcaacctcgcgatcatccagctcgtgcgcggcaattacgcggccggctggcgc
ggccacgaggcgcgctgggacggcgccggcgagctgcgcggccgccgcccggcgctgccg
ggcccgcgttggcagggcgagccgctcgccggcaagaccttgctcgtctggggcgagcag
gggctcggcgacgtgctgcagttcgcgcgcttcgtcgcgccgctcgccgagcgcgcgcac
cgcgaaggcggccggctcgtgtggaacacgtttccgcagctgggcgcgctgatgcagcgc
agcctcggcgcgcacgtggacgcgttcagcgccggcggcggtgtcgacacgctgccgccg
ttcgattacgaggtgccgctgatcggcctgccgttgatgctcgggatggagacgtcgacg
ctcggcgcgtcggtgccgtacctgcatgcggagccacatgcgcgcgacgcgtggcgcgcg
cggctcgcgggcgagcggcggctgaaggtcgggctcgtgtggacgggcagcgcggggcac
cagcgcaacccgttccggcgcgtcgggctcgcgcgctatgccgatgcgttcggcggcatc
gacggcgtcgcgttttattcgctgcagccgggcgcggatgccgatgtcgccgcggcgcgc
gcggccggtttcgcgatcgaggactttaccgccgagctgaagagtttcgacgacacggcg
gcgttcatcggcgcgctcgatctggtgatcacggtgtgcacgtcggttgcgcatctgtcg
ggcgcgctcggcgcgcgcacctgggtcgcgctcgacgtgaatccgcattggccgtggctg
ctcgatcgcaccgacagcccgtggtatccgagcgcgacgctctaccggcagccgacgttc
ggcgcctgggcgccggtgatggacgcgctcgcgcgcgatttgcgtgggctcgcggctggg
cggggttga

DBGET integrated database retrieval system