KEGG   Burkholderia vietnamiensis: Bcep1808_2860Help
Entry
Bcep1808_2860     CDS       T00493                                 

Definition
peptidase M48, Ste24p
Orthology
K07387  
putative metalloprotease [EC:3.4.24.-]
Organism
bvi  Burkholderia vietnamiensis
Brite
Enzymes [BR:bvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     Bcep1808_2860
Peptidases [BR:bvi01002]
 Metallo Peptidases
  Family M48: Ste24 endopeptidase family
   Bcep1808_2860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3171946..3172707)
Genome map
AA seq 253 aa AA seqDB search
MHIKKAAAACGVAFLLSACGGVQNLDANGLTSAGTSLFKAATLSDSDIAALSNDSCKASD
AESKIAAPNSAYSKRLTKVMKGFGDMTLNGQKINYKVYVTKDVNAWAMGNGCVRVYSGLM
DMMNDDELRGVIGHEMGHVALGHSKKAMQTAYAVSAARTAAGAASPGVAALTSSQLGDIT
EKFINAQFSQSQESAADDYSFDLMKQKNMSQKGLVTAFQKLAQLDGGKSSMMSSHPSSTS
RAQHIQDRIAKGS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcaagaaagcggcggcagcgtgtggcgtggcgttcctgttgagcgcgtgcggc
ggggtgcagaacctcgacgcgaacggcctgacgtcggcgggcaccagcctgttcaaggcg
gcgacgctgtcggacagcgacatcgcggccctgtcgaacgactcgtgcaaggcgagcgac
gcggaatcgaagatcgccgcgccgaacagcgcgtattcgaagcgtctgacgaaggtgatg
aagggcttcggcgacatgacgctgaacggccagaagatcaactacaaggtctacgtcacg
aaggacgtcaacgcgtgggcgatgggcaacggctgcgtgcgcgtgtacagcggcctgatg
gacatgatgaacgacgacgagctgcgcggcgtgatcggccatgaaatgggccacgttgcg
ctgggccactcgaagaaggcgatgcagacggcctacgccgtcagcgcggcgcgcacggcg
gccggcgcggcctcgcccggcgtcgcggcgctgaccagctcgcagctcggcgacatcacc
gagaagttcatcaacgcgcagttctcgcaatcgcaggaaagcgcggccgacgactattcg
ttcgacctgatgaagcagaagaacatgagccagaagggcctcgtcaccgcgttccagaag
ctcgcgcagctcgacggcggcaagagctcgatgatgagctcgcacccgtcgtcgacgagc
cgtgcgcagcacatccaggatcgcatcgcgaagggcagctga

DBGET integrated database retrieval system