KEGG   Burkholderia vietnamiensis: Bcep1808_2957Help
Entry
Bcep1808_2957     CDS       T00493                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcep1808_2957 (gpmA)
   01230 Biosynthesis of amino acids
    Bcep1808_2957 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep1808_2957 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Bcep1808_2957 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcep1808_2957 (gpmA)
Enzymes [BR:bvi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bcep1808_2957 (gpmA)
Exosome [BR:bvi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bcep1808_2957 (gpmA)
  Exosomal proteins of melanoma cells
   Bcep1808_2957 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3273228..3273974
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGRNEAYQAGALLKEAGYTFDIAYTSVLKR
AIRTLWHVQDKMDLMYLPVVHSWRLNERHYGALSGLNKAETAAKFGDDQVLVWRRSYDTP
PPALEPTDERAPFSDPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAVRAGKQVLIA
AHGNSLRALIKYLDGISDSDIVGLNIPNGVPLVYELDENLKPIQHYYLGDQDAIAKAQAA
VAKQGKAG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgttctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttc
accggctgggtcgacgtcgacctgaccgaacagggccgcaacgaagcctaccaggccggc
gcattgctcaaggaggccggctacacgttcgacatcgcgtacacgtcggtgctcaagcgc
gcgatccgcacgctgtggcacgtgcaggacaagatggacctgatgtatctgccggtcgtt
cactcgtggcgcctgaatgagcgccactacggcgcactgtcggggctgaacaaggccgaa
acggccgcgaagttcggcgacgaccaggtcctcgtctggcgccgcagctacgacacgccg
ccgcccgcgctcgagccgaccgacgaacgcgcgccgttcagcgatccgcgctacgcgaag
gtgccgcgcgagcagctgccgctcaccgaatgcctgaaggacacggtcgcgcgcgtgctg
ccgctgtggaacgagtcgatcgcgccggccgtgcgcgccggcaagcaggtgctgatcgcc
gcgcacggcaactcgctgcgcgcgctgatcaagtacctcgacggcatctcggacagcgac
atcgtcggcctgaacatcccgaacggcgtgccgctcgtctatgaactcgacgagaacctc
aagccgatccagcattactacctgggcgaccaggacgcgatcgcgaaggcgcaggccgcc
gtcgcgaagcaaggcaaggcgggctga

DBGET integrated database retrieval system