KEGG   Burkholderia vietnamiensis G4: Bcep1808_3006Help
Entry
Bcep1808_3006     CDS       T00493                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00071  Fatty acid degradation
bvi00280  Valine, leucine and isoleucine degradation
bvi00281  Geraniol degradation
bvi00310  Lysine degradation
bvi00360  Phenylalanine metabolism
bvi00362  Benzoate degradation
bvi00380  Tryptophan metabolism
bvi00410  beta-Alanine metabolism
bvi00627  Aminobenzoate degradation
bvi00640  Propanoate metabolism
bvi00650  Butanoate metabolism
bvi00903  Limonene and pinene degradation
bvi00930  Caprolactam degradation
bvi01100  Metabolic pathways
bvi01110  Biosynthesis of secondary metabolites
bvi01120  Microbial metabolism in diverse environments
bvi01130  Biosynthesis of antibiotics
bvi01212  Fatty acid metabolism
Module
bvi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bcep1808_3006
   00650 Butanoate metabolism
    Bcep1808_3006
  Lipid metabolism
   00071 Fatty acid degradation
    Bcep1808_3006
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcep1808_3006
   00310 Lysine degradation
    Bcep1808_3006
   00360 Phenylalanine metabolism
    Bcep1808_3006
   00380 Tryptophan metabolism
    Bcep1808_3006
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bcep1808_3006
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bcep1808_3006
   00281 Geraniol degradation
    Bcep1808_3006
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcep1808_3006
   00627 Aminobenzoate degradation
    Bcep1808_3006
   00930 Caprolactam degradation
    Bcep1808_3006
Enzymes [BR:bvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bcep1808_3006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABO55997
JGI: Bcen18083006
UniProt: A4JI94
Position
1:complement(3327875..3328774)
Genome map
AA seq 299 aa AA seqDB search
MFARAGLATLDSGVSTDPRTRELGMADLAAYGGYEALKVTRRAHGVLDIVMSGEGANRSG
LATANARMHRELADIWRDVDRDPDTRVAVIRGEGKGFSAGGDLALVEAMADDFDVRARVW
REARDLVYNVINCSKPIVSAMHGPAVGAGLVAGLLADISIAANDARIIDGHTRLGVAAGD
HAAIVWPLLCGMAKAKYYLLLCEPVSGAEAERIGLVSLAVEPDALLPKAYEVAERLAHGS
QSAIRWTKYALNNWLRSAGPTFDSSLALEFMGFSGPDVQEGIRSLRERRAPDFSPDAPF
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcccgcgcgggcttggctacactcgattcaggcgtttcaaccgacccacgaacc
cgggagctgggcatggccgatcttgccgcctatggcggttacgaagcattgaaggtgacg
cgtcgcgcgcatggcgtgctcgacatcgtgatgagcggcgagggcgcgaaccgcagcggc
ctcgccaccgcgaacgcgcggatgcatcgcgagctggccgacatctggcgcgacgtcgac
cgcgatcccgacacgcgggtcgcggtgatccgcggcgagggcaagggcttttcggcgggc
ggcgatctcgcgctcgtcgaggcgatggccgacgacttcgacgtgcgtgcgcgcgtgtgg
cgcgaggcgcgcgacctcgtctacaacgtgatcaactgcagcaagccgatcgtgtcggcg
atgcatgggccggcggtgggcgcggggctcgtcgcgggcctgctcgccgacatctcgatc
gccgcgaacgacgcgcgcatcatcgacggtcatacgcggctcggcgtcgcggccggcgat
catgcggcgatcgtctggccgctgctgtgcgggatggcgaaggcgaagtactacctgctc
ctgtgcgagccggtgagcggcgccgaggccgagcggatcggcctcgtgtcgctcgcggtc
gagccggacgcgctgctgccgaaggcgtacgaagtggccgagcggctcgcgcacggctcg
cagtcggcgatccgctggaccaagtacgcgctgaacaactggctgcgcagcgccgggccg
accttcgattcgtcgctcgcgctcgaattcatgggtttttccgggccggacgtgcaggaa
ggcatccgttcgctgcgcgagcggcgcgcacccgatttctccccggacgcgccgttctga

DBGET integrated database retrieval system