KEGG   Burkholderia vietnamiensis: Bcep1808_3206Help
Entry
Bcep1808_3206     CDS       T00493                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Bcep1808_3206
Enzymes [BR:bvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Bcep1808_3206
Transfer RNA biogenesis [BR:bvi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Bcep1808_3206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3549375..3550091)
Genome map
AA seq 238 aa AA seqDB search
MAIYRRGSAEVSNKADSSPVTEADLASHRVLAKHLAHLLPSCQVVSEEDPASLVYRQSAG
RFWLIDPLDGTKEFIARNGEFTVNIALIDEGRSTLGVVYAPAVDALYWGGSGLGAFRCIC
DQTVTINVEPAAEGHACRVVASKSHLNEATQAMIDRLGDVSLVQAGSSLKFCRVAEGEAD
IYPRLAPTCEWDTAAAQAVLEGAGGAVVDLHGQPLLYGKPDVINPSFIATRDTALIPA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctaccgacgcggatcggcggaagtgagcaacaaagcggattccagcccggta
accgaggctgacctggcgtcgcatcgtgtgctggccaaacacctggcccacctgctgcca
agttgccaagttgtttctgaagaagaccctgcgtcgctggtttaccgtcaaagcgcagga
cgtttctggttaattgacccactcgacggcaccaaagagttcatcgcccgaaatggggag
ttcacggtcaacatcgccttgattgatgaggggcgttcaactctgggggtggtgtatgcc
cctgcagttgatgcgctgtactggggtggatccggactgggtgcgtttcggtgcatatgc
gatcaaacggtcaccatcaatgtggagcctgctgcggaaggtcacgcatgccgtgtggtg
gccagtaaaagccacttgaacgaagcaacccaagccatgattgatcgcttgggtgacgtg
agtctggtccaggccggcagttcactcaaattctgccgggtggccgagggcgaggccgac
atctaccctcggttggcacccacttgtgagtgggacacggcggcagcccaggcggtgttg
gagggggcagggggcgcggtcgtggatcttcatggccaaccgttgctgtatggcaagccc
gatgtgatcaacccctccttcatcgccacccgcgatacagctttgattccagcatga

DBGET integrated database retrieval system