KEGG   Burkholderia vietnamiensis: Bcep1808_3428Help
Entry
Bcep1808_3428     CDS       T00493                                 

Definition
alcohol dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bvi01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:bvi00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:bvi00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(126581..127777)
Genome map
AA seq 398 aa AA seqDB search
MSSNRGVVYLGPGKVEVQKIDYPKMVDPTGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
PVGLVLGHEITGEVVEVGPDVETLKIGDLVSVPFNVACGRCAMCKDTHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDQAMAKIRDLTCLSDILPTGYHGAV
SAGVKPGSTVYIAGAGPVGMAAAASARLLGAAVTIVGDMNAERLAHARAMGFETVDLSKD
ASLGEQIAQILGVPEIDCAVDCVGFEAHGHGSSGSAEEAPATVLNSLMEITRPAGAIGIP
GLYVTDDPGAKDKAAQHGSLSIRFGLGWAKSHSFFTGQTPVLKYNRNLMQAILFDRLPIA
KIVNVEVISLDQAPEGYKKFDGGAPRKFVIDPHGLLAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgaggtgtcgtctatcttgggccgggcaaggtggaggtgcagaagatc
gattatccgaagatggtcgatccgaccgggcgcgcgatcggccacggcgtgatcctgaaa
gtggtgagcacgaacatctgcggttccgaccagcatatggtgcgcggccgcacgaccgcg
ccggtcggactcgtgctcggtcacgagatcaccggcgaggtggtcgaggtcggccccgac
gtcgagacgctgaagatcggcgatctcgtgtcggtgccgttcaacgtcgcgtgcggacgc
tgcgcgatgtgcaaggacacccatacgggcgtgtgcctgaacgtgaacccgtcgcgtgcg
ggcggcgcgtacggctacgtcgacatgggcggctggatcggcggacaggccgagtacgtg
ctcgtgccgtacgcggacttcaacctgctgaaattcccggaccgcgatcaggcgatggcg
aagatccgcgacctgacctgcctgtccgacattctgccgaccggctaccacggcgcggtg
agcgcgggcgtgaagccgggctcgacggtctatatcgcgggcgcaggcccggtcgggatg
gcggcggccgcgtcggcgcggctgctcggcgcggcggtcacgatcgtcggcgacatgaac
gcggaacgcctcgcccatgcgcgcgcgatgggcttcgagacggtcgacctgtcgaaggat
gcgtcgctcggcgagcagatcgcgcagattctcggcgtgccggaaatcgactgcgcggtc
gactgcgtcggcttcgaggcgcacggccacggctcgtcgggcagcgcggaggaagcgccg
gcgacggtgctgaactcgctgatggagatcacgcggccggccggcgcgatcggcatcccg
ggcctctacgtgaccgacgatccgggcgcgaaggacaaggccgcgcagcacggcagcctg
agcatccgcttcggcctcggctgggcgaagtcgcattcgttcttcacgggtcagacgccg
gtgctgaagtacaaccgcaacctgatgcaggcgatcctgttcgaccggctgccgatcgcg
aagatcgtcaacgtcgaggtgatctcgctcgatcaggcgccggaaggctacaagaagttc
gacggcggcgcaccgcgcaaattcgtgatcgacccgcacggcctgctcgcggcctga

DBGET integrated database retrieval system