KEGG   Burkholderia vietnamiensis: Bcep1808_3500Help
Entry
Bcep1808_3500     CDS       T00493                                 

Definition
TonB-dependent siderophore receptor
Orthology
K02014  
iron complex outermembrane recepter protein
Organism
bvi  Burkholderia vietnamiensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:213245..215440
Genome map
AA seq 731 aa AA seqDB search
MSFRRPLRRARALRPWRAGLPALITLCVAGGAHAQAQRAAPASAASAADAASPAAPPAAE
RELPAISVSASAVADPTVGYQPRTSSIAGGDDRALKDIPQSIAVVSSAVMEDQHANSLDD
VLGNVSGITQTNTLGGTRDAFIKRGFGSNNDGSVLVDGVRTPVLHSYLATIDRVEVLKGP
ASLLYGMQDPGGVINLVTRKPEAEFGGSISASRTSHGGSSAQFDLTGPLGKPGQVAGGTL
AFRLTGEYDTSRYWRSFGRERDALIAPALSWHDANTSIDVAYQYVDYTTPFDRGTVLVNG
RPDDALRYRRYEEAWSQSGGIQETLRARIEHRFSDAWRVRATYGWGRDRYDQYLTRAAAF
NSKTGALTRSSDANLGRNDADQIATLGLLGNLTLAGMHHALYIGGEYELQRSFRGDTIRG
TATKGFDLYDPVYGLLAPGGTVSAKQSDSLSKVHAYSMIVQDTVKLTERLTASAGLRWED
WQQESGMGRPFVFADRSHGNVWLPQFGLAYALTPSLTAYANVSRSFKPNVASNVAAPLAP
EFGRVLEAGLKFSMTPAISGTLAAYQIDKRNVAVTVGDLTSTIGTARSRGIELDVAGQLT
RHLSLIGSYAYTNANDRDSNTPLANVARHTGSLFAVYDTAIANLPGRWRFGGGARLVGAR
PGDTANSFTLPGYVTVDAFAAYETMVGKFPTRIQLNVKNLLDKTYYPSSNSNLIVAVGEP
RLVTLTTTVSF
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttcgtcgaccgctccgccgcgcgcgggctttgcgtccgtggcgcgcgggcctg
cctgccctgatcaccctttgcgtcgccggcggcgcacacgcgcaggcccagcgtgccgcg
cctgcctcggcggcctcggcggccgacgcggcgtcgcccgccgcgccgcccgcggccgag
cgcgaactgccggcgatcagcgtcagcgcgtcggcggtcgccgatccgaccgtcggctac
cagccgcgcaccagcagcatcgcgggcggcgacgatcgcgcgctcaaggacattccgcaa
tcgatcgccgtcgtcagcagcgccgtgatggaggaccagcacgcgaactcgctcgacgac
gtgctcggcaacgtcagcggcatcacgcagaccaacacgctcggcggcacgcgcgatgcg
ttcatcaagcgcggcttcggttcgaacaacgacggctcggtgctcgtcgacggcgtccgt
acgccggtgctgcacagctatctcgcgacgatcgatcgcgtcgaagtgctgaagggcccg
gcttcgctcctgtacgggatgcaggacccgggcggcgtgatcaatctcgtcacgcgcaag
ccggaggccgaattcggcggctcgatctcggcatcgcgcacgagccatggcggcagcagc
gcgcagttcgacctcaccggcccgctcggcaagccggggcaggtcgccggcggcacgctc
gcgttccgcctcaccggcgaatacgacacaagccgctactggcgcagcttcggccgcgag
cgcgatgcgctgatcgcgcccgcgctgtcgtggcacgacgcgaacacgtcgatcgacgtc
gcctatcaatacgtcgactacacgacgccgttcgaccgcggcaccgtgctcgtcaacggc
cgccccgacgatgcgctgcgctaccgccgctacgaggaggcgtggtcgcagagcggcggc
atccaggaaacgctgcgcgcgcgcatcgagcatcgcttctccgacgcgtggcgtgtccgc
gcgacctacggctggggccgcgatcgctacgatcagtacctcacgcgcgcggctgcgttc
aacagcaagaccggcgcgctgacgcgctcgtccgacgcgaacctcggccgcaacgacgcc
gaccagatcgcgacgctcggcctgctcggcaacctgacgctcgccgggatgcaccatgcg
ctgtacatcggcggcgaatacgaactgcagcgcagcttccgcggcgacacgatccgcggc
acggcgaccaagggcttcgatctctacgatcccgtgtacggcctgctcgcgccgggcggc
acggtcagcgccaagcaaagcgattcgctgtcgaaagtccacgcgtattcgatgatcgtg
caggacacggtgaagctcaccgagcggctcaccgcgtcggcggggctgcgctgggaggac
tggcagcaggaatcgggaatgggccggccgttcgtgttcgccgaccgctcgcacggcaac
gtgtggctgccgcagttcgggctcgcgtatgcgctcacgccgtcgctgaccgcgtacgcg
aacgtgagccgctcgttcaagccgaacgtcgcgtcgaacgtcgccgcgccgctcgcgccg
gagttcggccgcgtgctggaggccgggctgaagttcagcatgacgcccgcgatcagcggc
acgctcgccgcttaccagatcgacaagcgcaacgtcgcggtcaccgtgggcgacctcacg
tcgacgatcggcaccgcgcgctcgcgcgggatcgagctcgacgtcgccgggcagctcacg
cggcacctgagcctgatcggcagctacgcttacacgaacgcgaacgatcgcgacagcaac
acgccgctcgccaacgtcgcgcgccacaccggcagcctgttcgcggtgtacgacacggcg
atcgcgaatctgcccggacgctggcgcttcggcggcggcgcgcggctggtcggcgcgcgg
cccggcgacaccgcgaacagcttcacgctgcccggctacgtgacggtcgatgcgttcgcc
gcgtatgaaacgatggtcggcaagttcccgacgcgcatccagctgaacgtgaagaacctg
ctcgacaagacctactacccgtcgagcaacagcaacctgatcgtggcggtcggcgagccg
cggctcgtcacgctgacgaccacggtgtcgttctga

DBGET integrated database retrieval system