KEGG   Burkholderia vietnamiensis: Bcep1808_3532Help
Entry
Bcep1808_3532     CDS       T00493                                 

Definition
kumamolisin
Orthology
K08677  
kumamolisin
Organism
bvi  Burkholderia vietnamiensis
Brite
Peptidases [BR:bvi01002]
 Serine Peptidases
  Family S53
   Bcep1808_3532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(252518..254104)
Genome map
AA seq 528 aa AA seqDB search
MARHLQADREPRIVAESTCLGQCDPAERIHVTIMLRRREEGQLDALVHQLAAGDASAKPL
SRDAFAQRFSADPDDIRKTEEFAHRHQLTVDRVDPVESVVVLSGTIQQFEAAFSVKLERF
EHRAIGQYRGRTGPIALPDELGDAVTAVLGLDSRPQARPHFRLRPPFKPARGAAVTFTPV
QLASLYGFPAGDGAGQCIAIVELGGGYRAADIAQYFRGLGIDKPPTLVDVNVGTGRNAPT
GEASGPDGEVALDIEIAGAIAPAAKIAVYFAPNSDAGFIQAVNAAVTDKTNRPSVISISW
GGPEAIWQAQSAHAFNRVLQAAAAQGITVCAASGDSGSGDGLQDGADHVDFPASSPYVLG
CGGTQLDALPGQGIRSEVAWNDESAGGGAGGGGVSTMFDVPTWQQGLNVARVDGGRAPLA
KRGVPDVAGDASPQTGYEVAVAGTPAVMGGTSAVAPLWAALIARINAASGTSAGWINPVL
YKHPDALRDITKGSNGTYAAAPGWDACTGLGSPDGAKLAALLARKPSS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggcatcttcaagccgaccgtgaaccccgcatcgtcgccgagtcgacatgcctc
ggccagtgcgatccggcagaacgcatccacgtcacgatcatgttgcggcggcgggaagaa
gggcaactcgatgcattggttcaccagctcgcggccggcgacgcgagcgccaaaccgctg
tcgcgcgatgcattcgcgcagcgtttctccgccgatcccgacgacatccgcaagaccgag
gaattcgcgcaccgtcatcagctgacggtcgatcgcgtcgatccggtcgaaagcgtcgtc
gtgctgtccggcacgatccagcagttcgaagcggcgttcagcgtgaagctcgagcggttc
gagcatcgcgcgatcggccagtatcgcggccgcacgggcccgatcgcgctgccggacgag
ctcggcgatgccgtcacggcggtgctcggcctcgacagccgtccgcaggcacggccgcac
ttccggctgcgtccgccgttcaaacccgcgcgcggcgccgcggtcacctttaccccggtg
cagctcgcgtcgctgtacggctttccggccggcgacggcgccggccagtgcatcgcgatc
gtcgagctgggcggcggctatcgcgcggccgacatcgctcagtatttccgcgggctcggc
atcgacaagccgccgacgctcgtcgacgtgaacgtcggcaccggccgcaacgcgccgacc
ggcgaggcgagcggccccgacggcgaagtcgcgctcgacatcgaaatcgccggcgcgatc
gcgccagccgcgaagatcgccgtctacttcgcgccgaacagcgacgcgggcttcattcag
gcggtcaacgcggccgtcaccgacaagaccaatcggccgtcggtcatctcgatcagctgg
ggcggcccggaagcgatctggcaggcgcaatcggcgcacgcgttcaaccgcgtgctgcag
gccgccgccgcgcaagggatcacggtgtgcgcggcatcgggcgacagcggctccggcgac
gggctgcaggacggcgccgaccacgtcgatttccccgcgtcgagcccgtacgtgctcggc
tgcggcggcacgcagctcgatgcgctaccggggcagggcatccgcagcgaggtcgcgtgg
aacgacgagtcggccggcggcggcgcgggtggcggtggcgtcagcacgatgttcgacgtg
ccgacctggcagcaggggctcaacgtcgcgcgcgtcgacggcggccgcgcgccgcttgcg
aagcgcggcgtgccggacgtcgccggcgatgcgtcgccgcagacgggctacgaggtggcg
gtggccggcacgcccgcggtaatgggcggcacgagcgcggtcgcgccgttgtgggccgcg
ctgatcgcgcggatcaacgcggcgtccggcacgtcggccggctggatcaatccggtgctg
tacaagcatccggacgcgttgcgcgacatcacgaagggctcgaacggcacgtatgcggcc
gcaccgggctgggatgcgtgcactggcctcggcagccccgacggcgcgaagctcgccgcg
ctcctcgcgcgcaagccgtcgagctga

DBGET integrated database retrieval system