KEGG   Burkholderia vietnamiensis: Bcep1808_3746Help
Entry
Bcep1808_3746     CDS       T00493                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bvi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:494407..495036
Genome map
AA seq 209 aa AA seqDB search
MGKKTTRPEPAASRPTREEAEDAVRVLLRWAGDDPAREGLLDTPARVVRAYEQFFAGYAL
EPRDILARTFSEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLAR
LVDAFAKRLQIQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGVHKPGVEMVTSRM
LGTFRTDPSTRREFLSIVANPSSVNLTNT
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagaaaaccacgcggcccgaaccggccgcctcccggccgacccgggaagaagcc
gaggatgccgttcgcgtgctgctgcgctgggccggcgacgatccggcccgcgaaggcctg
ctcgacaccccggcgcgggtcgtgcgcgcatacgagcagttcttcgccggctatgcgctg
gagccgcgcgacatcctcgcgcgcaccttcagcgaagtcgacggctacgacgaaatgatc
gtgctgaaggacatccgcttcgagagctactgcgagcatcacatggtgccgatcatcggc
cgtgcgcacgtggcctatctgccgaaccatcgcgtcgtcggcatctcgaagctcgcgcgc
ctcgtcgatgccttcgccaagcgcctgcagatccaggaaaagatgaccgtgcagatcgcc
gatacgctgttcgacgtgctgcagccgaagggcgtcggcgtgatcctcgaagccgcgcac
cagtgcatctcgacgcgcggcgtgcacaagcccggcgtggaaatggtcacgtcgcgcatg
ctcggcacgttccgcaccgatccgtcgacgcggcgcgaattcctgtcgatcgtcgcgaac
ccttcttcagtcaacctcaccaacacgtaa

DBGET integrated database retrieval system