KEGG   Burkholderia vietnamiensis G4: Bcep1808_3778Help
Entry
Bcep1808_3778     CDS       T00493                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00072  Synthesis and degradation of ketone bodies
bvi00650  Butanoate metabolism
bvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcep1808_3778
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Bcep1808_3778
Enzymes [BR:bvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Bcep1808_3778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR THF_DHG_CYH_C Epimerase 3HCDH_N IF2_N
Motif
Other DBs
NCBI-ProteinID: ABO56761
JGI: Bcen18083778
UniProt: A4JKF8
Position
2:524523..525308
Genome map
AA seq 261 aa AA seqDB search
MSNLNGKTAVVTGAASGIGKEIALELAKAGAAVAIADLNQDGANAVADEINKAGGKAIGV
AMDVTSEDAVNSGIDKVAETFGSVDILVSNAGIQIVNPIENYSFADWKKMQAIHVDGAFL
TTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNVR
SHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGNTVDGVFTTVQDVAQTVLFLS
AFPSAALTGQSFVVSHGWFMQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacctgaatggcaagaccgcagtcgtcacgggcgccgcgagcggcatcggcaag
gaaatcgcgctggagctggcgaaggccggcgcggccgtcgcgatcgccgacctgaaccag
gacggcgcgaacgcggtggccgacgagatcaacaaggccggcggcaaggcgatcggcgtc
gcgatggacgtcaccagcgaggacgcggtgaacagcggcatcgacaaggtcgccgagacg
ttcggctcggtcgacatcctggtgtcgaacgcgggcatccagatcgtcaacccgatcgag
aactactcgttcgcagactggaagaagatgcaggcgattcacgtcgacggcgcgttcctc
acgaccaaggctgcgctcaagcacatgtacaaggacgaccgcggcggcgtcgtgatctac
atgggctcggtgcactcgcacgaggcgtcgccgctgaagtcggcgtacgtgacggccaag
catgggctgctggggctcgcgcgcgtgctggccaaggaaggcgcgaagcacaacgtgcgc
tcgcatgtggtgtgtccgggcttcgtgcgcacgccgctggtcgacaagcagattccggag
caggcgaaggagctcggcatcagcgaggaagaagtggtgaagaaggtgatgctcggcaac
acggtggacggcgtgttcacgacggtgcaggacgtcgcgcagacggtgctgttcctgtcg
gcgttcccgagcgccgcgctcaccggccagtcgttcgtcgtcagccacggctggttcatg
caataa

DBGET integrated database retrieval system