KEGG   Burkholderia vietnamiensis: Bcep1808_3847Help
Entry
Bcep1808_3847     CDS       T00493                                 

Definition
porin
Organism
bvi  Burkholderia vietnamiensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:608278..609417
Genome map
AA seq 379 aa AA seqDB search
MKHTKALLAAGACALAASGAHAQSSVTLYGIIDTGVEFVSHANAAGDHVVRMPGVTGELP
SRWGLRGTEDLGGGYQAVFTLESGFNVRGGDLGQGGRLFGRQAFVGLKSGFGTLAFGRQY
TMTYLALQGADIIGPDIYGLGSFDAYVPNGRADNAVTYVGTYRGVTLGAAYSFGRDGAGT
GNSPGQGTCAGQVPGDAVQCRNWSVMLKYDSAYFGAAASYEEQRGGTGAAANFFDGVAPV
PFTSSGGKDARTHVSAYAQAAGARLGAGWIGRRVSTGSPAAPGAHSDLFFVGASYAVKPA
FIVDGEGYRIVNSAHDTRATMATLRATYLLSKRTAVYAQSSYLWNSAHARYAVSGGGAGT
TPGAGMGQLGAMVGVRHMF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacaccaaagccttgctggcggccggcgcatgcgcgctcgccgcgtccggcgcc
cacgcgcagtcgagcgtgacgctgtacggaatcatcgatacgggcgtcgagttcgtgtcg
cacgcgaacgcggccggcgatcacgtcgtgcgcatgccgggcgtgaccggcgaactgccg
tcgcgctgggggctgcgcggcacggaggatctcggcggtggctatcaggcggtgttcacg
ctggaaagcggcttcaacgtgcgcggcggcgatctcggccagggcggccggctgttcggg
cgtcaggcgttcgtcgggctgaagagcggcttcggcacgctggccttcggccgccagtac
acgatgacctatctcgcgctgcagggcgccgacatcatcggccccgacatctacgggctc
ggctcgttcgacgcctacgtgccgaacggccgcgcggacaacgccgtgacctacgtcggc
acgtatcgcggcgtgacgctcggcgccgcctactcgttcgggcgcgacggcgccggcacc
ggcaactcgccggggcagggcacgtgcgcgggacaggtgccgggcgacgccgtccagtgc
cgcaactggtcggtgatgctcaagtacgacagcgcgtatttcggcgcggcggcgtcgtac
gaggagcagcgcggcggcacgggcgcggccgcgaacttcttcgacggcgtcgcgccggtg
ccgttcacgagcagcggcggcaaggatgcgcgcacgcacgtgagcgcctatgcgcaggcg
gccggcgcgcggctcggcgcgggctggatcgggcggcgcgtgtcgaccggttcgccggcg
gcgccgggtgcgcattcggacctgttcttcgtcggcgcgtcgtatgcggtgaagccggcg
ttcatcgtcgacggcgagggctaccggatcgtcaacagcgcgcacgacacgcgcgcgacg
atggccacgctgcgcgcgacctatctgctgagcaagcgcacggccgtctatgcgcaatcg
tcgtatctgtggaacagcgcgcatgcgcgctacgcggtcagcggcggcggcgccggcacg
acgcccggcgcggggatggggcagctcggcgcgatggtcggcgtgcgccacatgttctga

DBGET integrated database retrieval system