KEGG   Burkholderia vietnamiensis: Bcep1808_3999Help
Entry
Bcep1808_3999     CDS       T00493                                 

Definition
hypothetical protein
Organism
bvi  Burkholderia vietnamiensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:780511..782115
Genome map
AA seq 534 aa AA seqDB search
MVAFRHHASLKIANATRTSTEVPLIVANRVMRILANFDTIRLAHGVNRNSDINHQTKLMR
TTKTTLTRSVCAALASILLITGCATKHAASRRTAVQEGRNTSIPTNLAADAPKDGARIVF
TTSGMPMAVGFSTSTSDQACTGFQSVGAVFDSGRGALLPSIASLTEKLNKAVLRTETSRA
VNVKPGVQIQVKGLYGDDMDRRSDSCGPFVTALVPEKGHVYHVNFAFDGTQSCSQSMTDI
TVRDHPVSVGRPLHCSLRDLRASMGGNPLRAKHEQALAAARIHEAAANSAFDKASALQDE
AAALDSLGESDAALARINEALQLADPAKSKDLIATKAGILFSLNDPQQALSILVPEIEKT
REFAARNPQLARVGVLGTYTEGFVTATFAHIQLQQWKAAIDTLADAEAPLEGPSFYAYRA
LVYRYIMARAHDPALANPRLERDATYYAANDKNQYGVLLRIWQGEDALKALSIVNAGLSG
EERQEAEAEEQFYLGAYAKFVKGDADAARSRLRILDGIAPYGSIEWVYGKRVLQ
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
gtggtggcgttccgccatcacgcaagtttgaaaatcgccaacgcaactcggacatcaacc
gaggtgccgcttatcgtcgcaaatcgcgtgatgaggatattggcgaactttgatacgatt
cgactcgcacatggggtgaatcgaaattcagacataaatcaccaaaccaaactcatgcga
acgaccaaaacaaccttgacgcgatccgtttgcgcggcattagcgtcaattctcttgatc
acggggtgtgcgaccaagcacgcagcatcacgcaggaccgcggtgcaggaaggcagaaat
acttctataccgacgaacctcgccgctgacgctccgaaggatggtgcaagaatcgtcttt
acgacgagcggcatgcccatggcggtgggcttttcgacaagcacgtcggatcaggcatgc
accggattccaatcggtcggagcagtcttcgatagcgggcggggagcactactgccgtcc
attgcgagtttgaccgagaagctcaacaaggctgtcctcagaaccgagacgtcgcgcgcg
gtaaacgtgaagcccggcgtacaaatccaggtcaagggtctctacggcgacgatatggac
cgccgttcggattcgtgcggaccgttcgtcaccgctttggtgccggaaaaggggcacgtg
tatcacgtcaattttgcgttcgatggcacgcagagctgttcgcagagcatgacggatatt
acggtccgcgaccatccggtttccgtggggcgtccgcttcattgctcactgcgagatctc
agagcttcgatgggcggtaatccgctccgggcgaagcacgagcaggcgcttgcggctgca
cggatacacgaggcggctgcaaattcggcattcgacaaggcgtcggcgttgcaggacgag
gccgccgcgctcgattccctcggcgaatccgacgcagcgcttgcgcgaatcaacgaggcg
ttgcaattggccgatcccgccaaaagcaaggatttgatcgccacgaaagccggcatattg
ttctcgctgaacgatccgcagcaggcgctctcgattctggttccggaaatagaaaagacg
cgcgagttcgcggcgcgcaacccacaacttgcacgcgtcggtgtactgggtacctatacc
gaaggattcgtcacggccactttcgcgcatattcagttgcagcaatggaaggcggcaatc
gatacattggccgatgccgaggctccgctggaagggccgagcttctatgcgtaccgtgcg
ctggtctaccgctacatcatggctcgtgcccacgatcccgcgttggcgaatccgcggctc
gaacgggacgcgacttactacgccgcgaacgacaagaaccaatacggagtcttgttgcgc
atatggcagggcgaggacgcgctgaaggcgctttcgatcgtcaatgccgggttgtccggc
gaggagcggcaggaggcggaagccgaagagcagttctatctcggcgcttatgcgaagttc
gtcaaaggcgatgccgacgccgcgcgcagcaggctgcgtatcctcgatgggattgcgcct
tacggcagtatcgaatgggtgtacggcaaacgcgtccttcaataa

DBGET integrated database retrieval system