KEGG   Burkholderia vietnamiensis: Bcep1808_4009Help
Entry
Bcep1808_4009     CDS       T00493                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bvi01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bvi01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:794163..795122
Genome map
AA seq 319 aa AA seqDB search
MAEADLSSSRTPAAARAADADTDSRARRLAYLTVGVPALGFVLAIAYTWTYGVRATDFIL
LAVMYFSTAIGVETGMHRYFSHRAFKGRPIVTVMLGVFGSMAAQGPILFWAATHRMHHAF
TDQDGDPHSPLPRANRHGRPSRLAGLWHGHVGWLFSVRRENWSAYAADLLRDRLIVNLNL
RYGWWVLLGLALPALAGALLAPAGQALTGAVGGFLWGGLARIFLLDQSTWAVNSLCHTIG
TRPHATRDHSRNLGLLAIVSVGGAWHNNHHAQPAFANNDHAFWQLDPSAWVIRLLDALGL
VTEVRYAPKRRATVPSISP
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcagatctctcgtcgtcgcgaacacccgcggccgcccgtgcggccgacgcc
gacaccgactcgcgcgcgcgccggctcgcttatctgaccgtcggcgttcccgcgctcggt
ttcgtgctcgcgattgcctacacgtggacatacggcgtgcgcgccaccgacttcatcctg
ctcgcggtgatgtatttctcgaccgcgatcggcgtcgaaaccggcatgcaccgttacttc
tcacaccgtgcgttcaagggacggccgatcgtcaccgtgatgctcggcgtattcggcagc
atggctgcccaggggccgatcctgttctgggccgcgacgcaccgcatgcaccacgcgttc
accgatcaggacggcgatcctcattcgccgctgccgcgcgcgaaccgccacggccgaccg
agccggctcgcgggcctttggcacggtcacgtgggctggctgttcagcgtgcgccgcgag
aactggagcgcgtatgccgcggacctgctgcgcgaccgcctgatcgtcaatctcaatctg
cgctatgggtggtgggtgctgctcggcctcgcgctgcccgcgctggcgggcgcgttgctc
gcgccggccgggcaggccttgaccggcgccgtcggcggtttcctgtggggcgggctcgca
cggatcttcctgctcgatcagtcgacctgggccgtcaattcgctgtgccacaccatcggc
acccgcccgcacgcgacgcgcgaccacagccgcaatctgggcctgctcgcgatcgtctcg
gtgggcggcgcgtggcacaacaaccatcacgcacagccggccttcgccaacaacgatcac
gcgttctggcagctcgatccttccgcctgggtcatccgcctgctcgacgcgctggggctc
gtcacggaggtgcgctatgcgcccaagcgccgcgcgacggttccttcaatttcgccgtaa

DBGET integrated database retrieval system