KEGG   Burkholderia vietnamiensis: Bcep1808_4009Help
Entry
Bcep1808_4009     CDS       T00493                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Bcep1808_4009
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Bcep1808_4009
Enzymes [BR:bvi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Bcep1808_4009
Lipid biosynthesis proteins [BR:bvi01004]
 Desaturase
  First
   Bcep1808_4009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:794163..795122
Genome map
AA seq 319 aa AA seqDB search
MAEADLSSSRTPAAARAADADTDSRARRLAYLTVGVPALGFVLAIAYTWTYGVRATDFIL
LAVMYFSTAIGVETGMHRYFSHRAFKGRPIVTVMLGVFGSMAAQGPILFWAATHRMHHAF
TDQDGDPHSPLPRANRHGRPSRLAGLWHGHVGWLFSVRRENWSAYAADLLRDRLIVNLNL
RYGWWVLLGLALPALAGALLAPAGQALTGAVGGFLWGGLARIFLLDQSTWAVNSLCHTIG
TRPHATRDHSRNLGLLAIVSVGGAWHNNHHAQPAFANNDHAFWQLDPSAWVIRLLDALGL
VTEVRYAPKRRATVPSISP
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcagatctctcgtcgtcgcgaacacccgcggccgcccgtgcggccgacgcc
gacaccgactcgcgcgcgcgccggctcgcttatctgaccgtcggcgttcccgcgctcggt
ttcgtgctcgcgattgcctacacgtggacatacggcgtgcgcgccaccgacttcatcctg
ctcgcggtgatgtatttctcgaccgcgatcggcgtcgaaaccggcatgcaccgttacttc
tcacaccgtgcgttcaagggacggccgatcgtcaccgtgatgctcggcgtattcggcagc
atggctgcccaggggccgatcctgttctgggccgcgacgcaccgcatgcaccacgcgttc
accgatcaggacggcgatcctcattcgccgctgccgcgcgcgaaccgccacggccgaccg
agccggctcgcgggcctttggcacggtcacgtgggctggctgttcagcgtgcgccgcgag
aactggagcgcgtatgccgcggacctgctgcgcgaccgcctgatcgtcaatctcaatctg
cgctatgggtggtgggtgctgctcggcctcgcgctgcccgcgctggcgggcgcgttgctc
gcgccggccgggcaggccttgaccggcgccgtcggcggtttcctgtggggcgggctcgca
cggatcttcctgctcgatcagtcgacctgggccgtcaattcgctgtgccacaccatcggc
acccgcccgcacgcgacgcgcgaccacagccgcaatctgggcctgctcgcgatcgtctcg
gtgggcggcgcgtggcacaacaaccatcacgcacagccggccttcgccaacaacgatcac
gcgttctggcagctcgatccttccgcctgggtcatccgcctgctcgacgcgctggggctc
gtcacggaggtgcgctatgcgcccaagcgccgcgcgacggttccttcaatttcgccgtaa

DBGET integrated database retrieval system