KEGG   Burkholderia vietnamiensis: Bcep1808_4178Help
Entry
Bcep1808_4178     CDS       T00493                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bvi02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:984196..985215
Genome map
AA seq 339 aa AA seqDB search
MNIGIVNDLPLAVEALRRVIASRTEHRVLWVATDGDEAVDFCIAQPPDLVLMDLVMPKLD
GVAATRQIMARAPCAILIVTADVSANTSSVYEAMGAGALDAVDTPTLALGLPSDAAPQPL
LAKIDQIGRLLESRAAPLAPCARMPACGQPTLVAIGASAGGPTALTALLRALPADFPAAL
VIVQHVDQAFAVGMAEWLDGHTRLPVRIARQGGVPRAGEVLLAATNDHLSLSPRGVLGYT
RHPVDTPYRPSIDVFFTSVADGWRGDALGVLLTGMGRDGALGLKAMRAKGCYTIAQDEAT
SAVYGMPKAAAALGAAAAILPLERIAPRLISRVMRRSPD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcggcatcgtcaacgatctgccgctggccgtcgaggcgctgcgccgggtgatc
gcctcgcgcaccgaacatcgcgtgctgtgggtcgcgaccgacggcgacgaagcggtggac
ttctgcatcgcgcagccgcccgatctcgtgctgatggatctcgtgatgccgaagctcgac
ggcgtcgccgcgacgcggcagatcatggcgcgtgcgccgtgcgcgatcctgatcgtgacc
gcggacgtcagcgcgaacacgtcgtcggtctacgaggcgatgggcgcgggcgcgctcgat
gcggtcgacacgccgacgctcgcgctcggcctgccgtcggacgccgcgccgcagccgctg
ctcgcgaagatcgaccagatcggccgcctgctcgaaagccgcgcggcgccgctcgcgccg
tgcgcgcggatgccggcgtgcggccagccgacgctcgtcgcgatcggcgcgtccgccggc
gggccgaccgcgctcaccgcgctgctgcgcgcgttgccggccgatttcccggccgcgctg
gtgatcgtgcagcacgtcgatcaggcgttcgcggtcggcatggcggagtggctcgacggc
cacacgcggctgcccgtgcgcatcgcgcggcagggcggcgtgccgcgtgcgggcgaggtg
ctgctggccgccaccaacgatcacctgagcctgtcgccgcgcggcgtgctcggctatacg
cggcacccggtcgacacgccgtaccggccgtcgatcgacgtgttcttcaccagcgtcgcc
gacggctggcggggcgacgcgctcggcgtgctgctgacgggcatggggcgcgacggcgcg
ctggggttgaaggcgatgcgcgcgaagggctgctacacgatcgcgcaggacgaggcgacc
agtgcggtgtacgggatgccgaaggccgccgcggcgctcggcgcggcggcggcgatcctg
ccgctcgagcgcatcgcgccgcggctcatctcgcgcgtgatgcgtcgctcgcccgactga

DBGET integrated database retrieval system