KEGG   Burkholderia vietnamiensis: Bcep1808_4386Help
Entry
Bcep1808_4386     CDS       T00493                                 

Definition
peptidase M23B
Orthology
K06194  
lipoprotein NlpD
Organism
bvi  Burkholderia vietnamiensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1209504..1210286
Genome map
AA seq 260 aa AA seqDB search
MPEGGGRRNDANPGGPLRETIPIHEALTRWLPQAALVVAAAALSGCTMTPWTDSWQPMRS
STPMSAATPGVIAGYYRVNPGDTLASVAAAYGQRVQDVASWNHMSPNDALSPGQVLRVAP
PPAATSLTQAPSASAQPGSLAWPATGIVATPFSAGKTRGIVIAASGPDHSVRAAANGRVV
YAGTGVKAYGPLVILKHDNGLITAYGHNGKLLVNEGDAVRTGQPIAEMGTDPSGRATFEF
EVRQNGKVADPMNFLARNGG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgccggagggcggtgggcggcgcaacgacgcaaaccccggaggacccttgagagaaacg
attccgatccacgaggcgctgacgcgctggctgccgcaggcggcgttggtcgtcgcggcc
gcggcgctgtcgggctgtacgatgacgccgtggaccgacagctggcagccgatgcgatcg
tcgacgccgatgtcggccgcgacgcccggcgtgatcgccggctattaccgcgtcaacccg
ggcgacacgctcgcgagcgtcgcggctgcctacgggcagcgcgtgcaggacgtcgcgagc
tggaaccacatgtcgcccaacgacgcgctgtcgcccggccaggtgctgcgcgtcgcgccg
ccgccggccgcgacgtcgctcacgcaggcgccgtccgcctccgcgcagccgggctcgctg
gcatggccggctaccggcatcgtcgcgacgccgttctcggccggcaagacgcgcggcatc
gtgattgccgcgtcggggcccgatcattcggtgcgcgccgcggcgaacgggcgcgtggtt
tatgccgggacgggcgtcaaggcatatgggccgctcgtgatcctgaagcatgacaacggc
ctgatcaccgcgtacggacacaacggcaagctgctcgtgaacgaaggcgacgcggtgcgc
acggggcagccgatcgccgagatgggcaccgatccgagcggacgcgcgacgttcgagttc
gaagttcgccagaacggcaaggtcgccgatccgatgaacttcctggcgcgcaacggcggc
tga

DBGET integrated database retrieval system