KEGG   Burkholderia vietnamiensis G4: Bcep1808_4462Help
Entry
Bcep1808_4462     CDS       T00493                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcep1808_4462
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcep1808_4462
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcep1808_4462
Enzymes [BR:bvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcep1808_4462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:1300309..1301502
Genome map
AA seq 397 aa AA seqDB search
MYNLPDDHGHFGPYGGVFVAETLIHALDELRAAYEKFRNDPEFVAEYERELKYFVGRPSP
IYHAQRWSEMLGGAQIYLKREDLNHTGAHKINNVIGQALLAKRMGKKRVIAETGAGQHGV
ATATICARFGMECVVYMGAEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNIESTFYIIGTVAGPHPYPAMVRDFQRVIGDECRVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDTSVQLIGVEAAGEGLASGHHAASLIAGSPGVLHGNRTYLLQDENGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVAITDDEALKAFHDCCRIEGIIPALESSHALAY
AVKLAPTLPKDKILLVNLSGRGDKDMHTVAERTGIAL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacctccctgatgatcacggccacttcggcccgtatggcggcgtattcgtcgcc
gaaacgctgattcacgcgctggacgaactgcgcgcggcgtacgaaaaattccgcaatgac
cccgaatttgtcgccgagtatgagcgcgagctcaagtacttcgtcggccggccgtcgccg
atctatcacgcgcagcgctggagcgagatgctcggcggcgcgcagatctacctgaagcgc
gaagacctgaaccacaccggcgcgcacaagatcaacaacgtgatcggccaggcgctgctc
gcgaagcgcatgggcaagaaacgcgtgatcgccgagacgggcgccggccagcacggcgtc
gcgaccgcgacgatctgcgcgcgcttcgggatggagtgcgtcgtctacatgggcgcggaa
gacgtgcgccgccaggccgccaacgtctaccggatgaagctgctcggcgcgacggtcgtg
ccggtcgaatcgggttcgcgcacgctgaaggacgcgctcaacgaggcgatgcgcgactgg
gtcacgaacatcgaaagcacgttctacatcatcggcacggtcgcgggcccgcatccgtat
ccggcgatggtgcgcgacttccagcgcgtgatcggcgacgagtgccgcgtgcagatgccg
gagctggccggccgtcaaccggacgcggtgatcgcgtgcgtgggcggcggctcgaacgcg
atgggcatcttctatccgtacatcgacgacacgtcggtgcagctgatcggcgtcgaagcg
gccggcgagggcctcgcgtcgggccatcacgcggcatcgctgatcgccggcagccccggc
gtgctgcacggcaaccgcacgtacctgctgcaggacgagaatggccagatcatcgagacg
cattcggtgtcggccggcctcgactatccgggcgtcggccccgagcacgcatggctgaag
gacagcggccgcgcgcagtacgtggcgatcaccgacgacgaagcgctgaaggcgttccac
gactgctgccggatcgaagggatcattccggcgctggagtcgagccatgcgcttgcatat
gccgtgaagctcgcgccgacgttgccgaaggacaagatcctgctcgtcaacctgtcgggc
cgcggcgacaaggacatgcacaccgtcgccgagcgaacgggcatcgcgctctga

DBGET integrated database retrieval system