KEGG   Burkholderia vietnamiensis G4: Bcep1808_4464Help
Entry
Bcep1808_4464     CDS       T00493                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcep1808_4464
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcep1808_4464
Enzymes [BR:bvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcep1808_4464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:1302453..1303271
Genome map
AA seq 272 aa AA seqDB search
MSNRIQQTFAALAEQGRKGLIPFITAGDPDPAKTVEFMHALAAGGADVIELGVPFSDPMA
DGPVIQRSSERALARGVTLKTVLADVKRFRETDQKTPVVLMGYANPIERMGVDAFATEAH
AAGVDGVLVVDYPPEEAGVFAEKMRAAQIDPIFLLAPTSTDERIADVGKIASGYVYYVSL
KGVTGAGNLDVSSIAGKIPAIKSRVPVPVGVGFGIRDAETARAVAEVSDAVVIGSRLVQL
LESAAPEGAAAALKSFIAELRAALDGAGKTAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaccgtatccagcagaccttcgcggcgctcgccgaacaaggccgcaagggcctg
atcccgttcatcacggccggcgatcccgatcccgcgaagaccgtcgagttcatgcacgcg
ctcgccgcgggcggcgccgacgtgatcgagctcggcgtgccgttctcggacccgatggcc
gacggcccggtgatccagcgctcgtcggagcgcgcgctcgcgcgcggcgtcacgctcaag
accgtgctcgccgacgtgaagcgctttcgcgagaccgaccagaaaacccccgtcgtgctc
atgggttatgcgaacccgatcgagcggatgggtgtcgacgcgttcgcgaccgaagcccac
gcggccggcgtcgacggcgtgctcgtggtcgactatccgcccgaggaagccggcgtgttc
gccgagaaaatgcgcgccgcgcagatcgatccgatcttcctgctcgcgccgacgtcgacc
gacgaacgcatcgcggacgtgggcaagatcgcgagcggctacgtgtactacgtgtcgctg
aagggcgtgaccggcgccggaaatctggatgtttcgagcattgcgggtaaaatcccggcc
atcaagtcgcgcgtgccggtaccggtgggcgtcggcttcggcatccgcgacgccgaaacg
gcgcgcgcggtggccgaagtgtcggacgccgtcgtgatcggcagccgtctggtgcaattg
ctcgaaagcgccgcaccggaaggcgccgccgccgcgctgaagtcgttcatcgccgagctg
cgcgccgcgctggacggcgccggcaagacggcgcgataa

DBGET integrated database retrieval system